Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FXZ0

Protein Details
Accession L8FXZ0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
117-139TTSANWGKKARKRQRAMIKRIIEHydrophilic
NLS Segment(s)
PositionSequence
124-133KKARKRQRAM
Subcellular Location(s) cyto 13, cyto_nucl 8.5, cysk 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MTELNDLIGTVLGYIVQGFENLKHNAEHYASMSLKEWVRIVTIIGAYLLLRPYLSQWAAKLQSAQHDKEIVADEMATPATGPKAAISANSLRGQVEVPEDSESDEDTCEAVEATAETTSANWGKKARKRQRAMIKRIIEADEKLRAETEACDDEEDKDIEQYLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.05
5 0.06
6 0.09
7 0.14
8 0.16
9 0.17
10 0.17
11 0.18
12 0.21
13 0.21
14 0.21
15 0.17
16 0.21
17 0.2
18 0.21
19 0.21
20 0.21
21 0.21
22 0.2
23 0.19
24 0.14
25 0.15
26 0.14
27 0.13
28 0.11
29 0.11
30 0.09
31 0.09
32 0.08
33 0.07
34 0.08
35 0.08
36 0.05
37 0.05
38 0.05
39 0.07
40 0.11
41 0.12
42 0.11
43 0.12
44 0.17
45 0.19
46 0.19
47 0.2
48 0.17
49 0.24
50 0.27
51 0.28
52 0.24
53 0.23
54 0.23
55 0.23
56 0.24
57 0.16
58 0.12
59 0.11
60 0.09
61 0.08
62 0.08
63 0.06
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.04
71 0.04
72 0.05
73 0.07
74 0.09
75 0.12
76 0.13
77 0.14
78 0.13
79 0.13
80 0.13
81 0.12
82 0.12
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.1
90 0.08
91 0.08
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.08
106 0.11
107 0.12
108 0.13
109 0.18
110 0.27
111 0.35
112 0.46
113 0.54
114 0.61
115 0.67
116 0.75
117 0.81
118 0.84
119 0.85
120 0.84
121 0.78
122 0.71
123 0.68
124 0.61
125 0.52
126 0.44
127 0.39
128 0.36
129 0.32
130 0.29
131 0.26
132 0.23
133 0.22
134 0.21
135 0.22
136 0.18
137 0.18
138 0.2
139 0.2
140 0.21
141 0.24
142 0.23
143 0.19
144 0.17