Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59KG7

Protein Details
Accession Q59KG7   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
41-64SLLSYGNKKSKRRNQKNTTPANITHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, cyto_nucl 3.5, nucl 3, mito 2, cyto 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0043231  C:intracellular membrane-bounded organelle  
GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
KEGG cal:CAALFM_C208340CA  -  
Amino Acid Sequences MLLIYHHNQDQYVELSKRSTGSGGIAGIVIFIFIVIVIFISLLSYGNKKSKRRNQKNTTPANITLGSLNLESQNVHQGVARIQQQQQQNSGITTSPEHDYVPPYTQTPNDNDLGRFDKQGNFHLSNRPEGVQPPLPPPPVYLNPTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.25
4 0.25
5 0.23
6 0.2
7 0.14
8 0.14
9 0.15
10 0.13
11 0.12
12 0.11
13 0.1
14 0.09
15 0.08
16 0.06
17 0.03
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.04
30 0.05
31 0.07
32 0.1
33 0.17
34 0.24
35 0.3
36 0.4
37 0.5
38 0.61
39 0.71
40 0.79
41 0.82
42 0.85
43 0.9
44 0.88
45 0.83
46 0.75
47 0.65
48 0.57
49 0.47
50 0.37
51 0.27
52 0.19
53 0.15
54 0.1
55 0.1
56 0.07
57 0.06
58 0.06
59 0.06
60 0.1
61 0.09
62 0.09
63 0.1
64 0.1
65 0.11
66 0.14
67 0.17
68 0.16
69 0.18
70 0.23
71 0.27
72 0.28
73 0.29
74 0.28
75 0.25
76 0.23
77 0.22
78 0.17
79 0.13
80 0.12
81 0.12
82 0.11
83 0.11
84 0.12
85 0.12
86 0.14
87 0.16
88 0.18
89 0.17
90 0.17
91 0.18
92 0.19
93 0.21
94 0.23
95 0.24
96 0.24
97 0.25
98 0.24
99 0.26
100 0.28
101 0.27
102 0.25
103 0.23
104 0.25
105 0.25
106 0.31
107 0.35
108 0.34
109 0.36
110 0.42
111 0.42
112 0.43
113 0.43
114 0.39
115 0.33
116 0.31
117 0.35
118 0.32
119 0.32
120 0.33
121 0.37
122 0.39
123 0.37
124 0.38
125 0.39
126 0.4