Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G005

Protein Details
Accession L8G005    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-114GFLFYIRKRGRKKLSRITSRVRRMRKQSSTPKRSHydrophilic
NLS Segment(s)
PositionSequence
87-114RKRGRKKLSRITSRVRRMRKQSSTPKRS
Subcellular Location(s) nucl 12, plas 7, cyto_nucl 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARYRQLFMSFQQQHLHQLRVQHLHQQSVRQPPPPPPRPRRQTSPTTSPTIPPTTPNSSTSKAWISGPVIGSIAVLALIIGFLFYIRKRGRKKLSRITSRVRRMRKQSSTPKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.43
4 0.33
5 0.36
6 0.39
7 0.41
8 0.41
9 0.41
10 0.39
11 0.43
12 0.43
13 0.43
14 0.43
15 0.48
16 0.49
17 0.45
18 0.45
19 0.48
20 0.57
21 0.61
22 0.65
23 0.64
24 0.71
25 0.76
26 0.8
27 0.79
28 0.75
29 0.74
30 0.71
31 0.72
32 0.65
33 0.62
34 0.56
35 0.49
36 0.46
37 0.4
38 0.33
39 0.26
40 0.27
41 0.27
42 0.28
43 0.29
44 0.3
45 0.29
46 0.29
47 0.29
48 0.25
49 0.21
50 0.2
51 0.19
52 0.16
53 0.15
54 0.15
55 0.13
56 0.12
57 0.11
58 0.1
59 0.08
60 0.07
61 0.04
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.04
71 0.04
72 0.13
73 0.17
74 0.26
75 0.32
76 0.43
77 0.54
78 0.62
79 0.72
80 0.75
81 0.82
82 0.85
83 0.86
84 0.87
85 0.87
86 0.87
87 0.87
88 0.85
89 0.84
90 0.83
91 0.87
92 0.85
93 0.86
94 0.86