Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FXL5

Protein Details
Accession L8FXL5   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-72QSRRRSSRTVPPKPEERKLPPBasic
NLS Segment(s)
PositionSequence
55-69RRSSRTVPPKPEERK
Subcellular Location(s) nucl 17, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MDTVRARRMIWEKELRGGDLEDQEGEDGGGNHRNTKRSSATVTMTMEGRVGQSRRRSSRTVPPKPEERKLPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.47
3 0.41
4 0.37
5 0.3
6 0.23
7 0.21
8 0.14
9 0.13
10 0.12
11 0.1
12 0.09
13 0.07
14 0.05
15 0.06
16 0.11
17 0.11
18 0.17
19 0.19
20 0.22
21 0.23
22 0.27
23 0.28
24 0.25
25 0.28
26 0.26
27 0.26
28 0.27
29 0.27
30 0.24
31 0.21
32 0.19
33 0.16
34 0.13
35 0.12
36 0.13
37 0.13
38 0.18
39 0.26
40 0.35
41 0.41
42 0.46
43 0.49
44 0.51
45 0.61
46 0.66
47 0.69
48 0.69
49 0.7
50 0.75
51 0.79
52 0.81