Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FM92

Protein Details
Accession L8FM92    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
163-188GERPQFQIWRRSWRRRRGRGRSWRRGBasic
NLS Segment(s)
PositionSequence
172-188RRSWRRRRGRGRSWRRG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MMSDSANTTVPPTTTQSTSSAAAATPDSGERAHPLQPPQLPLTPNPQPPSPAHTPPKHAEDARGRSSAPPPLSTGSFAAPSSKAHPSDGTGLPPPQFRGSRSASPVRKKGGPGQCSALAGFAAGASQDQLSAAATAAADPAATISSADPAAAASSVVSPAPGGERPQFQIWRRSWRRRRGRGRSWRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.26
5 0.27
6 0.25
7 0.2
8 0.17
9 0.16
10 0.15
11 0.12
12 0.1
13 0.09
14 0.1
15 0.1
16 0.1
17 0.13
18 0.14
19 0.18
20 0.21
21 0.24
22 0.29
23 0.32
24 0.35
25 0.35
26 0.37
27 0.34
28 0.32
29 0.37
30 0.37
31 0.4
32 0.39
33 0.36
34 0.35
35 0.35
36 0.41
37 0.4
38 0.41
39 0.44
40 0.44
41 0.49
42 0.5
43 0.54
44 0.51
45 0.46
46 0.45
47 0.45
48 0.48
49 0.46
50 0.43
51 0.38
52 0.35
53 0.37
54 0.36
55 0.28
56 0.23
57 0.2
58 0.21
59 0.22
60 0.21
61 0.19
62 0.14
63 0.14
64 0.13
65 0.12
66 0.11
67 0.11
68 0.13
69 0.16
70 0.16
71 0.15
72 0.16
73 0.16
74 0.2
75 0.2
76 0.18
77 0.16
78 0.17
79 0.17
80 0.17
81 0.17
82 0.16
83 0.16
84 0.16
85 0.19
86 0.23
87 0.25
88 0.29
89 0.37
90 0.39
91 0.45
92 0.48
93 0.46
94 0.44
95 0.43
96 0.47
97 0.47
98 0.43
99 0.39
100 0.39
101 0.37
102 0.35
103 0.33
104 0.24
105 0.15
106 0.12
107 0.1
108 0.05
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.04
130 0.04
131 0.04
132 0.06
133 0.06
134 0.06
135 0.06
136 0.05
137 0.06
138 0.06
139 0.05
140 0.04
141 0.05
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.08
148 0.1
149 0.13
150 0.16
151 0.2
152 0.24
153 0.31
154 0.38
155 0.38
156 0.46
157 0.48
158 0.56
159 0.63
160 0.71
161 0.74
162 0.78
163 0.85
164 0.87
165 0.93
166 0.92
167 0.93
168 0.94