Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G3X5

Protein Details
Accession L8G3X5    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-41DEGPRSTQRRRQNQPVEEEEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037445  MAGE  
IPR041898  MAGE_WH1  
IPR041899  MAGE_WH2  
IPR002190  MHD_dom  
Pfam View protein in Pfam  
PF01454  MAGE  
Amino Acid Sequences MAPGRKRRAEVAPESSNEQSEDEGPRSTQRRRQNQPVEEEEEEYTQNGAEEPTVIDAADGDEEEVGRDPRGTYGLVMKLVRYALACEFGRVPIRREGIREKVFGKHGGRRFQQLFDEAQVLLEEKFGMQMVELPSKEKVTLKDRRAAVQKAAATSTNRSYILKSILPQKYNIPAIITPSHIPSASAESAYMGLYTLIVSIIMLNGGRVSDEKLMRYLQRMNANVNTPVDKTEFLFAKMQKQGYVVKIKDNASGTDITEWMVGPRGKVEVGAEGVKGLVKTVYGDTAPDDLDVRLKASLGIKDGPERRERQVVEPEGEEQGRAGRRTRAAEAEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.55
3 0.48
4 0.4
5 0.32
6 0.25
7 0.22
8 0.24
9 0.21
10 0.22
11 0.21
12 0.28
13 0.34
14 0.4
15 0.44
16 0.5
17 0.59
18 0.66
19 0.76
20 0.79
21 0.8
22 0.81
23 0.8
24 0.76
25 0.67
26 0.61
27 0.51
28 0.43
29 0.35
30 0.28
31 0.21
32 0.14
33 0.12
34 0.1
35 0.08
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.06
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.12
58 0.11
59 0.11
60 0.15
61 0.17
62 0.2
63 0.2
64 0.19
65 0.19
66 0.19
67 0.18
68 0.13
69 0.13
70 0.1
71 0.16
72 0.16
73 0.16
74 0.16
75 0.18
76 0.25
77 0.24
78 0.26
79 0.27
80 0.3
81 0.3
82 0.34
83 0.39
84 0.41
85 0.43
86 0.43
87 0.39
88 0.4
89 0.42
90 0.43
91 0.41
92 0.4
93 0.42
94 0.47
95 0.47
96 0.5
97 0.5
98 0.46
99 0.44
100 0.38
101 0.33
102 0.27
103 0.26
104 0.18
105 0.16
106 0.13
107 0.12
108 0.09
109 0.08
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.04
116 0.07
117 0.09
118 0.13
119 0.13
120 0.14
121 0.15
122 0.16
123 0.17
124 0.16
125 0.18
126 0.23
127 0.32
128 0.34
129 0.4
130 0.4
131 0.45
132 0.48
133 0.46
134 0.4
135 0.36
136 0.34
137 0.28
138 0.28
139 0.24
140 0.2
141 0.2
142 0.19
143 0.17
144 0.17
145 0.16
146 0.16
147 0.16
148 0.18
149 0.16
150 0.16
151 0.23
152 0.26
153 0.27
154 0.27
155 0.27
156 0.28
157 0.28
158 0.26
159 0.19
160 0.15
161 0.17
162 0.17
163 0.17
164 0.13
165 0.13
166 0.14
167 0.12
168 0.12
169 0.09
170 0.13
171 0.12
172 0.11
173 0.1
174 0.1
175 0.1
176 0.1
177 0.09
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.06
196 0.11
197 0.12
198 0.13
199 0.15
200 0.17
201 0.18
202 0.21
203 0.23
204 0.24
205 0.3
206 0.31
207 0.33
208 0.34
209 0.35
210 0.34
211 0.32
212 0.28
213 0.21
214 0.21
215 0.19
216 0.16
217 0.15
218 0.17
219 0.17
220 0.17
221 0.22
222 0.22
223 0.27
224 0.31
225 0.31
226 0.27
227 0.29
228 0.3
229 0.31
230 0.38
231 0.32
232 0.33
233 0.37
234 0.38
235 0.4
236 0.38
237 0.33
238 0.27
239 0.27
240 0.23
241 0.19
242 0.18
243 0.14
244 0.12
245 0.11
246 0.09
247 0.14
248 0.13
249 0.12
250 0.13
251 0.14
252 0.13
253 0.14
254 0.14
255 0.11
256 0.13
257 0.14
258 0.13
259 0.11
260 0.12
261 0.12
262 0.11
263 0.09
264 0.07
265 0.06
266 0.08
267 0.09
268 0.11
269 0.1
270 0.11
271 0.12
272 0.13
273 0.13
274 0.12
275 0.12
276 0.11
277 0.14
278 0.13
279 0.13
280 0.12
281 0.12
282 0.14
283 0.17
284 0.19
285 0.19
286 0.22
287 0.23
288 0.31
289 0.36
290 0.39
291 0.43
292 0.45
293 0.46
294 0.52
295 0.53
296 0.52
297 0.56
298 0.57
299 0.52
300 0.5
301 0.47
302 0.43
303 0.4
304 0.33
305 0.23
306 0.24
307 0.26
308 0.26
309 0.28
310 0.3
311 0.35
312 0.4
313 0.45
314 0.45