Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G7S8

Protein Details
Accession L8G7S8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
167-189KPLSVARKPQKKKKPVIIHKTAEHydrophilic
NLS Segment(s)
PositionSequence
172-181ARKPQKKKKP
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018800  PRCC  
Pfam View protein in Pfam  
PF10253  PRCC  
Amino Acid Sequences MGLVDYSDSESSDNEQVSESKKPTKGSFQKVVDRSNPGKIKVSLPTTAAPTNDEPPAKRAKTSGGTFGGFNSFLPAPKKTGAAAPETLGGGATGNGRGGGLGSGVSLKTGAAPAFSRDPKPVYDGGDNYDGREEAKGGDSSMGLPPPTLAQTPAAEVKLVGKPLMFKPLSVARKPQKKKKPVIIHKTAEEPASQGPSSTTSEAPKAPPPKVSLFAVPQNTDDDIAPERKGEYQPMLYGAKPEEEEEPEVVKNPYYEDQYNDAESHHTVPPLAARAAPASTTSNSLDSIASDLQLSASERRQLFGRQGARNLTGSKVINFNTDEEYRNNEELRSAGEQAVHNPVRSIAPGKHSLKQLLNATVSQKEALEESFAKGYANRKEASGRYGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.22
5 0.29
6 0.29
7 0.33
8 0.37
9 0.42
10 0.45
11 0.53
12 0.59
13 0.61
14 0.67
15 0.66
16 0.72
17 0.73
18 0.75
19 0.7
20 0.69
21 0.63
22 0.63
23 0.6
24 0.54
25 0.55
26 0.5
27 0.49
28 0.48
29 0.48
30 0.41
31 0.39
32 0.38
33 0.36
34 0.36
35 0.32
36 0.29
37 0.27
38 0.28
39 0.3
40 0.31
41 0.28
42 0.3
43 0.39
44 0.36
45 0.35
46 0.34
47 0.35
48 0.4
49 0.42
50 0.44
51 0.39
52 0.38
53 0.37
54 0.36
55 0.32
56 0.24
57 0.21
58 0.18
59 0.14
60 0.16
61 0.19
62 0.2
63 0.21
64 0.22
65 0.23
66 0.2
67 0.24
68 0.23
69 0.24
70 0.24
71 0.21
72 0.21
73 0.2
74 0.19
75 0.14
76 0.12
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.07
97 0.06
98 0.07
99 0.08
100 0.11
101 0.17
102 0.2
103 0.21
104 0.22
105 0.24
106 0.24
107 0.27
108 0.27
109 0.24
110 0.26
111 0.25
112 0.25
113 0.31
114 0.29
115 0.26
116 0.25
117 0.21
118 0.17
119 0.17
120 0.14
121 0.08
122 0.1
123 0.1
124 0.09
125 0.1
126 0.09
127 0.1
128 0.11
129 0.11
130 0.09
131 0.08
132 0.08
133 0.08
134 0.1
135 0.09
136 0.08
137 0.09
138 0.09
139 0.11
140 0.13
141 0.12
142 0.11
143 0.11
144 0.13
145 0.13
146 0.13
147 0.11
148 0.09
149 0.12
150 0.13
151 0.21
152 0.18
153 0.16
154 0.19
155 0.27
156 0.32
157 0.31
158 0.38
159 0.38
160 0.48
161 0.55
162 0.62
163 0.64
164 0.69
165 0.76
166 0.78
167 0.81
168 0.81
169 0.84
170 0.83
171 0.76
172 0.68
173 0.64
174 0.55
175 0.44
176 0.34
177 0.25
178 0.17
179 0.16
180 0.14
181 0.1
182 0.09
183 0.11
184 0.13
185 0.13
186 0.13
187 0.12
188 0.14
189 0.15
190 0.17
191 0.2
192 0.22
193 0.22
194 0.24
195 0.26
196 0.27
197 0.28
198 0.28
199 0.25
200 0.23
201 0.27
202 0.27
203 0.24
204 0.22
205 0.21
206 0.2
207 0.18
208 0.15
209 0.12
210 0.12
211 0.13
212 0.12
213 0.11
214 0.12
215 0.14
216 0.14
217 0.15
218 0.15
219 0.15
220 0.15
221 0.18
222 0.19
223 0.16
224 0.17
225 0.15
226 0.14
227 0.13
228 0.14
229 0.12
230 0.13
231 0.15
232 0.14
233 0.15
234 0.14
235 0.15
236 0.15
237 0.13
238 0.11
239 0.12
240 0.14
241 0.16
242 0.17
243 0.18
244 0.22
245 0.24
246 0.25
247 0.22
248 0.2
249 0.18
250 0.18
251 0.18
252 0.15
253 0.14
254 0.12
255 0.12
256 0.14
257 0.15
258 0.14
259 0.11
260 0.11
261 0.12
262 0.12
263 0.12
264 0.12
265 0.12
266 0.12
267 0.15
268 0.15
269 0.15
270 0.15
271 0.16
272 0.14
273 0.11
274 0.14
275 0.11
276 0.1
277 0.09
278 0.09
279 0.08
280 0.09
281 0.11
282 0.11
283 0.13
284 0.19
285 0.19
286 0.2
287 0.23
288 0.24
289 0.27
290 0.33
291 0.39
292 0.37
293 0.41
294 0.44
295 0.44
296 0.44
297 0.4
298 0.33
299 0.31
300 0.28
301 0.26
302 0.26
303 0.24
304 0.26
305 0.25
306 0.26
307 0.25
308 0.26
309 0.27
310 0.24
311 0.3
312 0.31
313 0.32
314 0.31
315 0.26
316 0.25
317 0.23
318 0.25
319 0.22
320 0.19
321 0.18
322 0.21
323 0.21
324 0.23
325 0.32
326 0.29
327 0.26
328 0.25
329 0.25
330 0.23
331 0.24
332 0.26
333 0.21
334 0.25
335 0.34
336 0.38
337 0.42
338 0.46
339 0.5
340 0.49
341 0.52
342 0.52
343 0.48
344 0.46
345 0.43
346 0.42
347 0.38
348 0.36
349 0.3
350 0.24
351 0.2
352 0.18
353 0.16
354 0.18
355 0.17
356 0.18
357 0.19
358 0.19
359 0.18
360 0.2
361 0.27
362 0.3
363 0.34
364 0.32
365 0.33
366 0.4
367 0.42