Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G6D4

Protein Details
Accession L8G6D4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-76PTEPTRMAPPKPKPRRRIPRPSLQNQYIHydrophilic
NLS Segment(s)
PositionSequence
56-68APPKPKPRRRIPR
Subcellular Location(s) mito 12, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MTAPFEVAPRRPSPAISSMPTMTGAGAADVLETKGVDAVAKSEAPAPAPTEPTRMAPPKPKPRRRIPRPSLQNQYIYAHPALTLNSILAAEAARPVKGAEADEAEIDWRLLAAAATKRGCNPSVTSNDTALFTPAMSVTSLASTLVDRASVHSSITAAGSQATSTDRYGWEESLSARSSLDLGARAGEETERGFSGGADMMAPPPAAAQERGFMGKRGLLWKVLTMNARGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.37
4 0.39
5 0.34
6 0.34
7 0.33
8 0.28
9 0.21
10 0.16
11 0.13
12 0.08
13 0.08
14 0.06
15 0.06
16 0.06
17 0.06
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.09
27 0.09
28 0.1
29 0.12
30 0.12
31 0.14
32 0.15
33 0.16
34 0.16
35 0.2
36 0.21
37 0.22
38 0.22
39 0.24
40 0.29
41 0.31
42 0.34
43 0.39
44 0.48
45 0.55
46 0.65
47 0.72
48 0.74
49 0.81
50 0.88
51 0.89
52 0.9
53 0.87
54 0.87
55 0.87
56 0.87
57 0.85
58 0.78
59 0.71
60 0.61
61 0.56
62 0.46
63 0.39
64 0.3
65 0.21
66 0.17
67 0.14
68 0.12
69 0.11
70 0.1
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.04
78 0.06
79 0.07
80 0.07
81 0.07
82 0.07
83 0.08
84 0.08
85 0.09
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.06
94 0.05
95 0.03
96 0.03
97 0.03
98 0.03
99 0.05
100 0.06
101 0.1
102 0.11
103 0.11
104 0.13
105 0.15
106 0.16
107 0.14
108 0.15
109 0.17
110 0.21
111 0.25
112 0.25
113 0.24
114 0.24
115 0.24
116 0.22
117 0.17
118 0.12
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.07
136 0.1
137 0.1
138 0.1
139 0.1
140 0.1
141 0.1
142 0.1
143 0.08
144 0.06
145 0.06
146 0.06
147 0.05
148 0.06
149 0.07
150 0.08
151 0.08
152 0.1
153 0.1
154 0.14
155 0.16
156 0.16
157 0.15
158 0.15
159 0.15
160 0.18
161 0.19
162 0.15
163 0.13
164 0.13
165 0.13
166 0.13
167 0.13
168 0.1
169 0.09
170 0.09
171 0.1
172 0.1
173 0.1
174 0.09
175 0.09
176 0.08
177 0.1
178 0.09
179 0.09
180 0.09
181 0.09
182 0.1
183 0.1
184 0.09
185 0.08
186 0.08
187 0.08
188 0.09
189 0.09
190 0.07
191 0.06
192 0.08
193 0.1
194 0.12
195 0.12
196 0.13
197 0.16
198 0.2
199 0.21
200 0.21
201 0.21
202 0.21
203 0.24
204 0.26
205 0.26
206 0.25
207 0.25
208 0.28
209 0.29
210 0.32
211 0.31