Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FP19

Protein Details
Accession L8FP19    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
110-131ASRGARRPVRPLRPLRPARRGABasic
NLS Segment(s)
PositionSequence
110-129ASRGARRPVRPLRPLRPARR
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
Amino Acid Sequences MHPHPCSRIPIRIKNPHSPYLKSHIPVLRTIPMPTPPAPSLHIALIAQTHRLSPAQSEMLCQDESPTAAPLFSSYYTPTHLCNPPVPPSAPAAVGEEAATQKPGAPPTAASRGARRPVRPLRPLRPARRGAIPTDPVQCVLGGGQWCCWVVVTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.77
4 0.73
5 0.66
6 0.62
7 0.59
8 0.58
9 0.49
10 0.5
11 0.45
12 0.42
13 0.41
14 0.4
15 0.37
16 0.32
17 0.33
18 0.28
19 0.28
20 0.3
21 0.28
22 0.29
23 0.25
24 0.26
25 0.26
26 0.26
27 0.24
28 0.2
29 0.2
30 0.14
31 0.14
32 0.15
33 0.13
34 0.12
35 0.11
36 0.1
37 0.1
38 0.11
39 0.11
40 0.09
41 0.12
42 0.14
43 0.14
44 0.14
45 0.14
46 0.16
47 0.16
48 0.15
49 0.12
50 0.09
51 0.1
52 0.1
53 0.1
54 0.07
55 0.07
56 0.07
57 0.06
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.11
64 0.12
65 0.13
66 0.16
67 0.18
68 0.19
69 0.2
70 0.22
71 0.24
72 0.26
73 0.26
74 0.22
75 0.22
76 0.21
77 0.19
78 0.17
79 0.15
80 0.12
81 0.12
82 0.11
83 0.1
84 0.09
85 0.09
86 0.09
87 0.06
88 0.08
89 0.09
90 0.1
91 0.11
92 0.1
93 0.12
94 0.16
95 0.23
96 0.25
97 0.24
98 0.28
99 0.33
100 0.41
101 0.45
102 0.42
103 0.46
104 0.52
105 0.6
106 0.65
107 0.68
108 0.68
109 0.73
110 0.81
111 0.81
112 0.8
113 0.77
114 0.71
115 0.71
116 0.65
117 0.58
118 0.57
119 0.52
120 0.47
121 0.46
122 0.43
123 0.35
124 0.33
125 0.29
126 0.2
127 0.17
128 0.16
129 0.14
130 0.14
131 0.14
132 0.16
133 0.16
134 0.16