Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8GBV8

Protein Details
Accession L8GBV8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
61-86RTLRKANRALSKRRKAKRTRVQDGWSHydrophilic
NLS Segment(s)
PositionSequence
64-79RKANRALSKRRKAKRT
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTVPQTPQTPADAILQSKFVQNRIGIHQGSSPTMIFSAVKQLVNGTDRIAHQMTLIQEEVRTLRKANRALSKRRKAKRTRVQDGWSLTIEDAQKLIAEKEDKGLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.2
4 0.24
5 0.24
6 0.21
7 0.21
8 0.21
9 0.24
10 0.27
11 0.32
12 0.28
13 0.27
14 0.28
15 0.26
16 0.25
17 0.23
18 0.18
19 0.12
20 0.12
21 0.11
22 0.09
23 0.08
24 0.14
25 0.14
26 0.15
27 0.14
28 0.14
29 0.16
30 0.17
31 0.17
32 0.11
33 0.11
34 0.11
35 0.14
36 0.14
37 0.12
38 0.11
39 0.13
40 0.12
41 0.12
42 0.12
43 0.09
44 0.08
45 0.09
46 0.1
47 0.11
48 0.11
49 0.11
50 0.15
51 0.22
52 0.26
53 0.32
54 0.4
55 0.44
56 0.54
57 0.64
58 0.7
59 0.74
60 0.78
61 0.82
62 0.82
63 0.87
64 0.86
65 0.86
66 0.86
67 0.84
68 0.8
69 0.77
70 0.71
71 0.64
72 0.54
73 0.44
74 0.35
75 0.3
76 0.27
77 0.2
78 0.16
79 0.12
80 0.12
81 0.12
82 0.13
83 0.14
84 0.16
85 0.16