Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G4H6

Protein Details
Accession L8G4H6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-36KATNTNPRSAKRRRAHRAACLAAHydrophilic
NLS Segment(s)
PositionSequence
24-27KRRR
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences FNEEHPSWSHQDIKATNTNPRSAKRRRAHRAACLAARLRQGPAPAMVCRRVVSQPTVSGEMQRIPALVFAVPRPERPKAAQLGTQVGREPGRAAGRGRQRHSTGLGLVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.46
4 0.43
5 0.48
6 0.46
7 0.5
8 0.54
9 0.54
10 0.62
11 0.64
12 0.72
13 0.75
14 0.8
15 0.81
16 0.81
17 0.81
18 0.77
19 0.7
20 0.64
21 0.57
22 0.5
23 0.46
24 0.37
25 0.29
26 0.25
27 0.23
28 0.19
29 0.19
30 0.17
31 0.16
32 0.18
33 0.19
34 0.18
35 0.18
36 0.19
37 0.18
38 0.18
39 0.18
40 0.17
41 0.17
42 0.18
43 0.21
44 0.19
45 0.18
46 0.17
47 0.16
48 0.15
49 0.13
50 0.11
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.14
58 0.15
59 0.18
60 0.22
61 0.24
62 0.27
63 0.3
64 0.36
65 0.34
66 0.36
67 0.36
68 0.35
69 0.4
70 0.38
71 0.36
72 0.31
73 0.28
74 0.26
75 0.22
76 0.21
77 0.18
78 0.2
79 0.22
80 0.23
81 0.29
82 0.38
83 0.46
84 0.5
85 0.53
86 0.53
87 0.54
88 0.56
89 0.52