Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FTX4

Protein Details
Accession L8FTX4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-120QQQVKDSKKKRGGRDRLQCGHydrophilic
NLS Segment(s)
PositionSequence
109-111KKR
163-178RRAGIEARKWERLRKK
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MIFTYLNPGIWPISCNTALEKLCTYSQPTQPTEPTTPTLPQPITPIPSTFQGVEQGLQQWKERVPEAFSSPSRQSYSNWLTGAARVLAAGQLQELDLRAVQQQVKDSKKKRGGRDRLQCGGELRASEAHELQAQKAELQTQKLAATEARKLSQAQTRAQKQLRRAGIEARKWERLRKKSIAQLTKSGLTIPPELEDPITDPEAESGSQYESATEGGSGRGSESEHENEEVVIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.26
5 0.26
6 0.27
7 0.27
8 0.25
9 0.26
10 0.27
11 0.31
12 0.3
13 0.36
14 0.4
15 0.42
16 0.44
17 0.45
18 0.49
19 0.47
20 0.43
21 0.4
22 0.36
23 0.34
24 0.32
25 0.35
26 0.3
27 0.27
28 0.29
29 0.29
30 0.3
31 0.29
32 0.28
33 0.24
34 0.25
35 0.27
36 0.22
37 0.19
38 0.19
39 0.18
40 0.18
41 0.17
42 0.19
43 0.19
44 0.2
45 0.21
46 0.19
47 0.21
48 0.23
49 0.23
50 0.21
51 0.21
52 0.22
53 0.25
54 0.29
55 0.28
56 0.31
57 0.31
58 0.33
59 0.32
60 0.3
61 0.27
62 0.3
63 0.34
64 0.32
65 0.31
66 0.28
67 0.26
68 0.26
69 0.26
70 0.17
71 0.12
72 0.07
73 0.07
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.08
87 0.09
88 0.1
89 0.14
90 0.21
91 0.27
92 0.34
93 0.38
94 0.45
95 0.53
96 0.59
97 0.64
98 0.69
99 0.73
100 0.75
101 0.81
102 0.78
103 0.74
104 0.67
105 0.59
106 0.49
107 0.41
108 0.31
109 0.21
110 0.15
111 0.12
112 0.12
113 0.12
114 0.11
115 0.1
116 0.11
117 0.12
118 0.11
119 0.12
120 0.12
121 0.11
122 0.11
123 0.14
124 0.13
125 0.15
126 0.15
127 0.14
128 0.14
129 0.14
130 0.14
131 0.13
132 0.13
133 0.15
134 0.17
135 0.17
136 0.18
137 0.18
138 0.21
139 0.25
140 0.26
141 0.29
142 0.35
143 0.4
144 0.47
145 0.52
146 0.52
147 0.53
148 0.57
149 0.56
150 0.51
151 0.47
152 0.48
153 0.5
154 0.52
155 0.55
156 0.51
157 0.55
158 0.53
159 0.6
160 0.61
161 0.61
162 0.64
163 0.63
164 0.65
165 0.65
166 0.73
167 0.73
168 0.67
169 0.65
170 0.61
171 0.55
172 0.49
173 0.41
174 0.34
175 0.28
176 0.26
177 0.2
178 0.17
179 0.16
180 0.17
181 0.16
182 0.14
183 0.13
184 0.15
185 0.15
186 0.14
187 0.13
188 0.13
189 0.14
190 0.14
191 0.12
192 0.1
193 0.1
194 0.12
195 0.12
196 0.11
197 0.1
198 0.11
199 0.1
200 0.1
201 0.08
202 0.08
203 0.09
204 0.08
205 0.09
206 0.09
207 0.1
208 0.11
209 0.16
210 0.19
211 0.21
212 0.22
213 0.22