Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FY20

Protein Details
Accession L8FY20    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-66TEGEVCPDGKRRRRKRCAPEVATDHydrophilic
NLS Segment(s)
PositionSequence
52-57KRRRRK
Subcellular Location(s) mito 9, plas 7, extr 6, E.R. 3
Family & Domain DBs
Amino Acid Sequences MPPHFHPRSRMTSSIFVTTLFASFAVVTLPHILPCPAPRVAYTEGEVCPDGKRRRRKRCAPEVATDGLVKAGQPCATTVVVGGGEDLEEIVGTREKRECPIPKPGGTMGIILAFTGIGNNTDGPGGTRPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.44
3 0.36
4 0.31
5 0.26
6 0.21
7 0.15
8 0.12
9 0.08
10 0.08
11 0.07
12 0.06
13 0.06
14 0.06
15 0.09
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.13
22 0.16
23 0.14
24 0.15
25 0.15
26 0.19
27 0.22
28 0.22
29 0.22
30 0.21
31 0.19
32 0.2
33 0.2
34 0.16
35 0.14
36 0.21
37 0.27
38 0.33
39 0.43
40 0.53
41 0.64
42 0.73
43 0.82
44 0.84
45 0.88
46 0.9
47 0.84
48 0.78
49 0.71
50 0.62
51 0.53
52 0.42
53 0.31
54 0.2
55 0.15
56 0.1
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.04
71 0.04
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.04
78 0.07
79 0.07
80 0.1
81 0.13
82 0.14
83 0.17
84 0.26
85 0.31
86 0.33
87 0.43
88 0.48
89 0.46
90 0.49
91 0.48
92 0.43
93 0.37
94 0.33
95 0.23
96 0.18
97 0.16
98 0.12
99 0.11
100 0.07
101 0.06
102 0.06
103 0.06
104 0.05
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.1
111 0.13