Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FU73

Protein Details
Accession L8FU73   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-79AELKSTEKRPRGRPHKRPIEEVDBasic
NLS Segment(s)
PositionSequence
63-74EKRPRGRPHKRP
87-92RERFKR
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 8.5, mito 5
Family & Domain DBs
Amino Acid Sequences MTRLVESQNAELRILREVKEYKEILETRKKRTTGKRIKLQGEFVFSTEEVLKIVREAELKSTEKRPRGRPHKRPIEEVDEEVEGRGRERFKRPRIGIGGVCGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.24
4 0.26
5 0.28
6 0.33
7 0.33
8 0.29
9 0.34
10 0.36
11 0.35
12 0.43
13 0.45
14 0.47
15 0.54
16 0.55
17 0.56
18 0.64
19 0.69
20 0.69
21 0.74
22 0.75
23 0.76
24 0.8
25 0.74
26 0.7
27 0.61
28 0.54
29 0.45
30 0.36
31 0.29
32 0.23
33 0.21
34 0.15
35 0.13
36 0.08
37 0.08
38 0.07
39 0.05
40 0.06
41 0.06
42 0.07
43 0.07
44 0.1
45 0.14
46 0.17
47 0.19
48 0.27
49 0.32
50 0.38
51 0.44
52 0.5
53 0.56
54 0.66
55 0.74
56 0.77
57 0.82
58 0.86
59 0.84
60 0.81
61 0.76
62 0.73
63 0.65
64 0.56
65 0.48
66 0.38
67 0.34
68 0.27
69 0.24
70 0.15
71 0.13
72 0.16
73 0.17
74 0.22
75 0.32
76 0.42
77 0.48
78 0.59
79 0.62
80 0.67
81 0.7
82 0.71
83 0.63