Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FZP5

Protein Details
Accession L8FZP5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
192-214LPIPLPRPPRRLRVPRRPAAESQHydrophilic
NLS Segment(s)
PositionSequence
197-209PRPPRRLRVPRRP
Subcellular Location(s) mito 16, nucl 5, cyto 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSCFTRSAMLRFQSLRAPLSRIGLSSLHPTPLRTIPRLPLARTFTSTIRLAAKKAFPKPLPQKQSPQNPPAAPPTQTYQSYTAKLASRSAQHPSTSPPPTPSTSSPPTPAPPSASPMRASATTLTSTAPPSGLSAWVPIAFAGICFLMAGMGGWLLFAPTSLIRSITAYPVKSLVANGQPTLRIDIELRRVLPIPLPRPPRRLRVPRRPAAESQHLRPPNAPRDSFGAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.32
4 0.33
5 0.29
6 0.32
7 0.31
8 0.26
9 0.25
10 0.23
11 0.22
12 0.25
13 0.24
14 0.24
15 0.24
16 0.24
17 0.26
18 0.32
19 0.36
20 0.33
21 0.35
22 0.35
23 0.44
24 0.47
25 0.45
26 0.46
27 0.46
28 0.45
29 0.45
30 0.44
31 0.35
32 0.36
33 0.34
34 0.29
35 0.3
36 0.28
37 0.27
38 0.28
39 0.34
40 0.36
41 0.41
42 0.47
43 0.41
44 0.51
45 0.59
46 0.65
47 0.66
48 0.64
49 0.68
50 0.68
51 0.77
52 0.74
53 0.69
54 0.66
55 0.58
56 0.56
57 0.54
58 0.48
59 0.39
60 0.33
61 0.32
62 0.3
63 0.3
64 0.3
65 0.28
66 0.28
67 0.28
68 0.27
69 0.27
70 0.25
71 0.25
72 0.24
73 0.22
74 0.22
75 0.23
76 0.27
77 0.25
78 0.23
79 0.24
80 0.26
81 0.31
82 0.3
83 0.29
84 0.27
85 0.28
86 0.29
87 0.32
88 0.3
89 0.29
90 0.3
91 0.31
92 0.3
93 0.29
94 0.29
95 0.27
96 0.26
97 0.23
98 0.2
99 0.22
100 0.22
101 0.22
102 0.21
103 0.2
104 0.2
105 0.16
106 0.16
107 0.13
108 0.13
109 0.12
110 0.11
111 0.11
112 0.1
113 0.1
114 0.1
115 0.09
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.04
146 0.04
147 0.05
148 0.06
149 0.07
150 0.07
151 0.1
152 0.11
153 0.15
154 0.19
155 0.18
156 0.19
157 0.19
158 0.19
159 0.18
160 0.17
161 0.16
162 0.18
163 0.19
164 0.19
165 0.19
166 0.2
167 0.21
168 0.24
169 0.2
170 0.15
171 0.15
172 0.2
173 0.25
174 0.27
175 0.26
176 0.25
177 0.26
178 0.25
179 0.29
180 0.32
181 0.3
182 0.35
183 0.44
184 0.48
185 0.56
186 0.61
187 0.65
188 0.68
189 0.74
190 0.77
191 0.79
192 0.84
193 0.83
194 0.85
195 0.81
196 0.77
197 0.74
198 0.74
199 0.69
200 0.63
201 0.65
202 0.61
203 0.58
204 0.57
205 0.57
206 0.56
207 0.58
208 0.54
209 0.47