Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FTQ5

Protein Details
Accession L8FTQ5   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-50ASPSRSSRHGGHKKHKSHKSNETGSBasic
NLS Segment(s)
PositionSequence
30-43RSSRHGGHKKHKSH
Subcellular Location(s) nucl 19, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MGWFDGASEVASSYILGGYGGTEGRASPSRSSRHGGHKKHKSHKSNETGSAFGDWAAGVSGGGVPRHGNRSTTSFLVLAPAPAQQHPPTAAPPAAASSRAPTPASGTSSANSSTSSRRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.09
12 0.13
13 0.15
14 0.18
15 0.25
16 0.28
17 0.32
18 0.37
19 0.38
20 0.46
21 0.53
22 0.59
23 0.63
24 0.69
25 0.76
26 0.81
27 0.86
28 0.83
29 0.82
30 0.82
31 0.8
32 0.76
33 0.73
34 0.65
35 0.55
36 0.48
37 0.4
38 0.3
39 0.21
40 0.15
41 0.08
42 0.05
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.05
52 0.06
53 0.11
54 0.11
55 0.12
56 0.13
57 0.18
58 0.2
59 0.2
60 0.21
61 0.17
62 0.16
63 0.17
64 0.15
65 0.11
66 0.09
67 0.1
68 0.1
69 0.1
70 0.13
71 0.12
72 0.14
73 0.16
74 0.17
75 0.17
76 0.19
77 0.19
78 0.16
79 0.16
80 0.17
81 0.16
82 0.16
83 0.15
84 0.14
85 0.16
86 0.18
87 0.19
88 0.16
89 0.19
90 0.22
91 0.25
92 0.24
93 0.24
94 0.22
95 0.24
96 0.25
97 0.21
98 0.19
99 0.18
100 0.22