Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FUX5

Protein Details
Accession L8FUX5   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-155SDAPGKDKQAPPQKKKKVKKVKLSFGDDEHydrophilic
NLS Segment(s)
PositionSequence
77-78KK
90-148AVGEPERKEEKIAAIGAARKRKVGKVVGAPEEEEGKVSDAPGKDKQAPPQKKKKVKKVK
Subcellular Location(s) cyto 10, cyto_nucl 9.833, cyto_mito 9.833, nucl 8.5, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSPKITSKGLSYDSSLLPFLQRLRAENTSGSTAAPRPKRAPNPDADEEDEPVYVDEEGADLDDDELHSLGVTKKAAKKGEEAAEEAKPEAVGEPERKEEKIAAIGAARKRKVGKVVGAPEEEEGKVSDAPGKDKQAPPQKKKKVKKVKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.21
4 0.19
5 0.19
6 0.18
7 0.21
8 0.21
9 0.22
10 0.28
11 0.3
12 0.31
13 0.31
14 0.31
15 0.28
16 0.27
17 0.24
18 0.2
19 0.21
20 0.27
21 0.29
22 0.32
23 0.34
24 0.42
25 0.51
26 0.57
27 0.58
28 0.58
29 0.62
30 0.61
31 0.6
32 0.55
33 0.47
34 0.41
35 0.36
36 0.28
37 0.2
38 0.15
39 0.12
40 0.08
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.05
57 0.07
58 0.07
59 0.1
60 0.14
61 0.19
62 0.22
63 0.22
64 0.24
65 0.27
66 0.31
67 0.29
68 0.27
69 0.25
70 0.23
71 0.22
72 0.2
73 0.15
74 0.1
75 0.09
76 0.07
77 0.06
78 0.08
79 0.1
80 0.12
81 0.16
82 0.18
83 0.18
84 0.19
85 0.19
86 0.17
87 0.18
88 0.16
89 0.13
90 0.13
91 0.18
92 0.22
93 0.28
94 0.27
95 0.27
96 0.29
97 0.31
98 0.35
99 0.36
100 0.37
101 0.39
102 0.45
103 0.46
104 0.45
105 0.43
106 0.38
107 0.35
108 0.28
109 0.2
110 0.15
111 0.12
112 0.11
113 0.11
114 0.15
115 0.14
116 0.19
117 0.23
118 0.28
119 0.33
120 0.36
121 0.45
122 0.52
123 0.62
124 0.67
125 0.73
126 0.79
127 0.83
128 0.9
129 0.92
130 0.92
131 0.92
132 0.93
133 0.93
134 0.93
135 0.92