Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FWF0

Protein Details
Accession L8FWF0   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-25PKKDSFKGKGKAKKVANPPPAPRBasic
NLS Segment(s)
PositionSequence
5-23KDSFKGKGKAKKVANPPPA
60-67KARNKKAK
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 5, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPKKDSFKGKGKAKKVANPPPAPRASPVEARLTEAECLGTIDAMVEKKQATAVKAAATKARNKKAKEEAAARSLTAARGKDEAPLASIEGYDARPSRTLLPLVLLAVGALLLALDALIQLWTCAAVSLPPHHMILRKKAKLNLCLRCSKQVYKDRRLLACEKKNPMSHCEYCVEQHNKCLPIPTFALRQFNRLADAFQLYRDTIQRDEETFSKTLANNRTKILAAVQKKYTAYPQKVNLGLAILEIASEVRSLRRTNHLGNDIQKAIHCHLPDVALAEEYKSSDSEDDVDREHVDGELEPLDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.8
4 0.81
5 0.81
6 0.8
7 0.79
8 0.79
9 0.75
10 0.68
11 0.61
12 0.57
13 0.52
14 0.5
15 0.47
16 0.45
17 0.41
18 0.43
19 0.41
20 0.36
21 0.31
22 0.25
23 0.22
24 0.14
25 0.15
26 0.11
27 0.08
28 0.06
29 0.06
30 0.08
31 0.09
32 0.09
33 0.1
34 0.1
35 0.11
36 0.15
37 0.17
38 0.16
39 0.19
40 0.2
41 0.23
42 0.26
43 0.27
44 0.29
45 0.3
46 0.38
47 0.44
48 0.52
49 0.54
50 0.54
51 0.61
52 0.66
53 0.7
54 0.68
55 0.66
56 0.62
57 0.6
58 0.58
59 0.49
60 0.41
61 0.34
62 0.29
63 0.25
64 0.2
65 0.16
66 0.18
67 0.18
68 0.19
69 0.19
70 0.17
71 0.15
72 0.14
73 0.13
74 0.11
75 0.11
76 0.08
77 0.08
78 0.08
79 0.1
80 0.1
81 0.11
82 0.12
83 0.13
84 0.16
85 0.17
86 0.17
87 0.15
88 0.16
89 0.15
90 0.14
91 0.12
92 0.1
93 0.07
94 0.05
95 0.05
96 0.03
97 0.02
98 0.02
99 0.01
100 0.01
101 0.01
102 0.01
103 0.01
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.03
114 0.05
115 0.07
116 0.1
117 0.11
118 0.12
119 0.13
120 0.18
121 0.2
122 0.29
123 0.36
124 0.38
125 0.4
126 0.45
127 0.49
128 0.53
129 0.59
130 0.57
131 0.52
132 0.54
133 0.53
134 0.54
135 0.53
136 0.48
137 0.48
138 0.49
139 0.53
140 0.53
141 0.58
142 0.57
143 0.55
144 0.55
145 0.54
146 0.54
147 0.54
148 0.53
149 0.52
150 0.51
151 0.53
152 0.51
153 0.48
154 0.46
155 0.39
156 0.36
157 0.33
158 0.29
159 0.27
160 0.34
161 0.34
162 0.27
163 0.31
164 0.33
165 0.33
166 0.32
167 0.35
168 0.27
169 0.25
170 0.27
171 0.24
172 0.25
173 0.26
174 0.34
175 0.3
176 0.32
177 0.31
178 0.29
179 0.29
180 0.24
181 0.22
182 0.15
183 0.18
184 0.15
185 0.14
186 0.15
187 0.12
188 0.13
189 0.15
190 0.16
191 0.14
192 0.17
193 0.18
194 0.18
195 0.2
196 0.21
197 0.23
198 0.21
199 0.2
200 0.2
201 0.2
202 0.25
203 0.31
204 0.36
205 0.34
206 0.34
207 0.36
208 0.33
209 0.32
210 0.31
211 0.29
212 0.29
213 0.32
214 0.33
215 0.35
216 0.35
217 0.36
218 0.4
219 0.41
220 0.42
221 0.43
222 0.46
223 0.49
224 0.5
225 0.49
226 0.4
227 0.32
228 0.26
229 0.19
230 0.14
231 0.08
232 0.06
233 0.05
234 0.05
235 0.04
236 0.04
237 0.05
238 0.07
239 0.11
240 0.12
241 0.16
242 0.25
243 0.3
244 0.35
245 0.43
246 0.46
247 0.48
248 0.51
249 0.54
250 0.47
251 0.42
252 0.38
253 0.34
254 0.32
255 0.31
256 0.27
257 0.22
258 0.22
259 0.23
260 0.21
261 0.2
262 0.18
263 0.14
264 0.14
265 0.14
266 0.13
267 0.13
268 0.13
269 0.11
270 0.12
271 0.11
272 0.12
273 0.14
274 0.17
275 0.18
276 0.19
277 0.21
278 0.2
279 0.2
280 0.19
281 0.16
282 0.14
283 0.12
284 0.12