Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8GAT3

Protein Details
Accession L8GAT3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20YARRMRLRKQQKALKTRGVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences YARRMRLRKQQKALKTRGVEMLRHGLKSLDELDEAEEKECREAEVKGTLLHSPSTAVSEGAAPDQDLFVALSPGFFDCLGVDGKMPPVALDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.76
3 0.69
4 0.67
5 0.61
6 0.52
7 0.45
8 0.47
9 0.4
10 0.36
11 0.33
12 0.25
13 0.22
14 0.23
15 0.21
16 0.12
17 0.11
18 0.11
19 0.12
20 0.14
21 0.14
22 0.12
23 0.12
24 0.11
25 0.11
26 0.11
27 0.09
28 0.09
29 0.08
30 0.1
31 0.11
32 0.12
33 0.11
34 0.12
35 0.12
36 0.12
37 0.12
38 0.1
39 0.08
40 0.08
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.06
65 0.08
66 0.09
67 0.09
68 0.1
69 0.09
70 0.11
71 0.13
72 0.12