Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D8PLC9

Protein Details
Accession A0A1D8PLC9    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
145-164TKDLKFPLPHRVQKSKKLFQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 10, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028877  50S_L18Ae/Ribosomal_L18a/L20  
IPR023573  Ribosomal_L18a//L18Ae/LX  
IPR021138  Ribosomal_L18a/L20_eukaryotes  
Gene Ontology GO:0009986  C:cell surface  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cal:CAALFM_C401520CA  -  
Pfam View protein in Pfam  
PF01775  Ribosomal_L18A  
Amino Acid Sequences MSRLNEYQVIGRNLPTESVPEPKLFRMRIFAPNTVVAKSRYWYFLQKLHKVKKASGEIVSVNIISEAKPTKVKTFGIWLRYESRSGIHNMYKEYRDVTRVGAVETMYQDLAARHRARFRSIHILKVVELEKTDDVKRQYVKQFLTKDLKFPLPHRVQKSKKLFQATAPTTFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.19
4 0.17
5 0.22
6 0.22
7 0.24
8 0.26
9 0.3
10 0.36
11 0.34
12 0.33
13 0.33
14 0.36
15 0.41
16 0.44
17 0.42
18 0.38
19 0.41
20 0.41
21 0.37
22 0.34
23 0.28
24 0.25
25 0.24
26 0.23
27 0.21
28 0.22
29 0.26
30 0.27
31 0.33
32 0.39
33 0.46
34 0.53
35 0.58
36 0.62
37 0.59
38 0.58
39 0.6
40 0.58
41 0.52
42 0.44
43 0.39
44 0.33
45 0.31
46 0.29
47 0.2
48 0.14
49 0.11
50 0.09
51 0.06
52 0.08
53 0.08
54 0.09
55 0.13
56 0.14
57 0.16
58 0.19
59 0.2
60 0.19
61 0.26
62 0.28
63 0.29
64 0.29
65 0.28
66 0.3
67 0.3
68 0.29
69 0.21
70 0.19
71 0.16
72 0.18
73 0.18
74 0.16
75 0.17
76 0.18
77 0.21
78 0.21
79 0.19
80 0.19
81 0.17
82 0.16
83 0.16
84 0.15
85 0.15
86 0.15
87 0.15
88 0.14
89 0.13
90 0.12
91 0.12
92 0.11
93 0.08
94 0.07
95 0.07
96 0.07
97 0.09
98 0.15
99 0.16
100 0.18
101 0.24
102 0.26
103 0.29
104 0.31
105 0.35
106 0.39
107 0.39
108 0.42
109 0.39
110 0.38
111 0.35
112 0.37
113 0.32
114 0.22
115 0.21
116 0.18
117 0.17
118 0.19
119 0.2
120 0.2
121 0.22
122 0.27
123 0.3
124 0.35
125 0.39
126 0.43
127 0.46
128 0.49
129 0.5
130 0.53
131 0.59
132 0.53
133 0.51
134 0.49
135 0.51
136 0.47
137 0.45
138 0.48
139 0.48
140 0.56
141 0.6
142 0.66
143 0.67
144 0.74
145 0.82
146 0.8
147 0.77
148 0.78
149 0.71
150 0.68
151 0.71
152 0.65