Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FZH3

Protein Details
Accession L8FZH3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-35LPPLPNLRVKRPNQNNNNPCHydrophilic
NLS Segment(s)
PositionSequence
96-98KRK
Subcellular Location(s) mito 24.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKKVAVPKALTARLPPLPNLRVKRPNQNNNNPCLGLMTSVLTCWASSGYSVAGCSALETSLRACMDKPRPKDVKKNTINYHLSRMYPQIVGPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.39
4 0.36
5 0.35
6 0.36
7 0.43
8 0.46
9 0.49
10 0.53
11 0.56
12 0.64
13 0.67
14 0.73
15 0.75
16 0.81
17 0.78
18 0.73
19 0.73
20 0.62
21 0.51
22 0.42
23 0.32
24 0.21
25 0.16
26 0.12
27 0.08
28 0.08
29 0.08
30 0.07
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.08
50 0.09
51 0.09
52 0.09
53 0.17
54 0.27
55 0.35
56 0.39
57 0.46
58 0.55
59 0.6
60 0.7
61 0.73
62 0.73
63 0.74
64 0.79
65 0.75
66 0.76
67 0.77
68 0.7
69 0.67
70 0.6
71 0.52
72 0.45
73 0.43
74 0.36
75 0.3
76 0.29
77 0.31
78 0.37