FuNGI

A0A1D8PK75

Protein Details

Accession

A0A1D8PK75

Localization Confidence

Low

Confidence Score

7.2

NoLS Segment(s)

Position	Sequence	Protein Nature
114-136	SKVLKFDNKSRSKKIQNRIDAKL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 10, cyto_nucl 9, nucl 7.5, cyto 7.5

Family & Domain DBs

InterPro	View protein in InterPro IPR033010 Cdc20/Fizzy IPR015943 WD40/YVTN_repeat-like_dom_sf IPR001680 WD40_repeat IPR036322 WD40_repeat_dom_sf
Gene Ontology	GO:0005680 C:anaphase-promoting complex GO:0010997 F:anaphase-promoting complex binding GO:1990757 F:ubiquitin ligase activator activity GO:0031145 P:anaphase-promoting complex-dependent catabolic process GO:0030476 P:ascospore wall assembly GO:0044778 P:meiotic DNA integrity checkpoint signaling GO:1905786 P:positive regulation of anaphase-promoting complex-dependent catabolic process GO:1903024 P:positive regulation of ascospore-type prospore membrane formation GO:0007130 P:synaptonemal complex assembly
KEGG	cal:CAALFM_C304870WA -
Pfam	View protein in Pfam PF00400 WD40

Amino Acid Sequences

MAISRSLITETSNRFIPSSSSTSVYKTRHKNELQSSYQSHENLDNNIPHANLSIRDDSLFTHSTSSISSNTHFQSSSSSIGSSSAIKRVTLGSTKPSDLHQKIVAEALNFVSSSKVLKFDNKSRSKKIQNRIDAKLVESLTIAEREVSVDAGKSRSTSSIKTIIATDILQAPGLRNDYYSNLVSWSFKTNRVAVGLGSKIYLWGVDNNVTQINHSNEDLVTAVSCSKEYWILVATAGGKIILMDQQSNSVVSEYTNNEGKCIFCFAWFDKSNMFIAGDDFGEVYIFKIHKLFNVQIELVRVFKCHQQQICGLALNGKNDEIAVGANDNCCTIWSIKDFSAPVLKFVLPHNAAIKALCYCPWTVSLLATGGGSKDRKIRFWHTSSGTLLSEYYTDGQITSLIWSRFRKEIVATFGFGGTSKSNLLCVYTYPQMQPILEVNAACNLRILSATLSPDYCSVCVATNDSTIRIYQLWEGSLEILPSATQRIMGAFGSDIIELLEGISKTGDVIR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.29
3	0.29
4	0.28
5	0.3
6	0.29
7	0.28
8	0.29
9	0.33
10	0.4
11	0.42
12	0.46
13	0.5
14	0.55
15	0.61
16	0.66
17	0.71
18	0.73
19	0.77
20	0.73
21	0.71
22	0.67
23	0.61
24	0.61
25	0.52
26	0.44
27	0.41
28	0.37
29	0.34
30	0.36
31	0.34
32	0.3
33	0.31
34	0.29
35	0.23
36	0.22
37	0.2
38	0.16
39	0.19
40	0.21
41	0.2
42	0.2
43	0.2
44	0.2
45	0.24
46	0.23
47	0.19
48	0.18
49	0.18
50	0.18
51	0.19
52	0.19
53	0.16
54	0.17
55	0.18
56	0.21
57	0.22
58	0.24
59	0.23
60	0.21
61	0.24
62	0.25
63	0.26
64	0.22
65	0.2
66	0.18
67	0.19
68	0.2
69	0.19
70	0.17
71	0.2
72	0.19
73	0.19
74	0.2
75	0.21
76	0.24
77	0.24
78	0.24
79	0.26
80	0.29
81	0.31
82	0.31
83	0.32
84	0.38
85	0.35
86	0.37
87	0.35
88	0.32
89	0.31
90	0.33
91	0.31
92	0.21
93	0.2
94	0.17
95	0.13
96	0.12
97	0.12
98	0.1
99	0.09
100	0.1
101	0.1
102	0.12
103	0.13
104	0.21
105	0.27
106	0.35
107	0.46
108	0.54
109	0.6
110	0.65
111	0.73
112	0.77
113	0.8
114	0.81
115	0.81
116	0.81
117	0.81
118	0.77
119	0.75
120	0.65
121	0.57
122	0.52
123	0.42
124	0.32
125	0.25
126	0.21
127	0.15
128	0.15
129	0.13
130	0.08
131	0.08
132	0.08
133	0.09
134	0.08
135	0.07
136	0.07
137	0.09
138	0.1
139	0.1
140	0.1
141	0.11
142	0.15
143	0.17
144	0.18
145	0.21
146	0.26
147	0.26
148	0.27
149	0.26
150	0.22
151	0.21
152	0.2
153	0.16
154	0.11
155	0.11
156	0.1
157	0.1
158	0.1
159	0.11
160	0.12
161	0.11
162	0.1
163	0.11
164	0.13
165	0.16
166	0.16
167	0.14
168	0.13
169	0.14
170	0.15
171	0.15
172	0.19
173	0.18
174	0.21
175	0.23
176	0.23
177	0.24
178	0.24
179	0.23
180	0.17
181	0.18
182	0.15
183	0.13
184	0.12
185	0.1
186	0.09
187	0.08
188	0.08
189	0.05
190	0.06
191	0.07
192	0.09
193	0.1
194	0.11
195	0.12
196	0.12
197	0.12
198	0.15
199	0.15
200	0.15
201	0.14
202	0.14
203	0.12
204	0.13
205	0.13
206	0.09
207	0.06
208	0.05
209	0.06
210	0.05
211	0.06
212	0.05
213	0.05
214	0.06
215	0.06
216	0.07
217	0.07
218	0.07
219	0.07
220	0.08
221	0.08
222	0.07
223	0.07
224	0.06
225	0.05
226	0.04
227	0.05
228	0.05
229	0.05
230	0.06
231	0.06
232	0.07
233	0.08
234	0.08
235	0.08
236	0.07
237	0.06
238	0.06
239	0.09
240	0.08
241	0.1
242	0.14
243	0.14
244	0.14
245	0.14
246	0.14
247	0.12
248	0.14
249	0.12
250	0.09
251	0.12
252	0.13
253	0.21
254	0.21
255	0.22
256	0.19
257	0.2
258	0.2
259	0.18
260	0.17
261	0.09
262	0.08
263	0.08
264	0.08
265	0.06
266	0.06
267	0.05
268	0.05
269	0.05
270	0.04
271	0.06
272	0.06
273	0.07
274	0.09
275	0.09
276	0.11
277	0.15
278	0.16
279	0.16
280	0.19
281	0.19
282	0.18
283	0.19
284	0.18
285	0.16
286	0.14
287	0.13
288	0.11
289	0.16
290	0.2
291	0.24
292	0.25
293	0.26
294	0.28
295	0.31
296	0.32
297	0.27
298	0.22
299	0.21
300	0.22
301	0.2
302	0.19
303	0.15
304	0.13
305	0.12
306	0.12
307	0.07
308	0.06
309	0.04
310	0.05
311	0.06
312	0.06
313	0.07
314	0.07
315	0.06
316	0.07
317	0.08
318	0.08
319	0.1
320	0.12
321	0.15
322	0.15
323	0.18
324	0.18
325	0.17
326	0.25
327	0.22
328	0.21
329	0.21
330	0.2
331	0.19
332	0.2
333	0.27
334	0.2
335	0.21
336	0.22
337	0.2
338	0.21
339	0.19
340	0.19
341	0.13
342	0.12
343	0.12
344	0.12
345	0.11
346	0.12
347	0.13
348	0.14
349	0.12
350	0.12
351	0.12
352	0.11
353	0.11
354	0.1
355	0.09
356	0.07
357	0.11
358	0.11
359	0.12
360	0.19
361	0.21
362	0.25
363	0.31
364	0.38
365	0.43
366	0.46
367	0.53
368	0.49
369	0.52
370	0.49
371	0.46
372	0.39
373	0.31
374	0.27
375	0.19
376	0.15
377	0.12
378	0.12
379	0.09
380	0.09
381	0.08
382	0.08
383	0.08
384	0.08
385	0.09
386	0.13
387	0.14
388	0.18
389	0.21
390	0.24
391	0.27
392	0.28
393	0.28
394	0.26
395	0.3
396	0.33
397	0.33
398	0.31
399	0.28
400	0.27
401	0.25
402	0.22
403	0.19
404	0.12
405	0.11
406	0.12
407	0.11
408	0.12
409	0.12
410	0.14
411	0.12
412	0.14
413	0.17
414	0.19
415	0.21
416	0.21
417	0.24
418	0.24
419	0.24
420	0.24
421	0.21
422	0.21
423	0.2
424	0.19
425	0.17
426	0.21
427	0.21
428	0.19
429	0.18
430	0.14
431	0.13
432	0.13
433	0.14
434	0.1
435	0.13
436	0.16
437	0.16
438	0.17
439	0.17
440	0.19
441	0.2
442	0.17
443	0.15
444	0.14
445	0.14
446	0.15
447	0.17
448	0.17
449	0.2
450	0.21
451	0.22
452	0.22
453	0.2
454	0.21
455	0.18
456	0.18
457	0.17
458	0.18
459	0.17
460	0.17
461	0.17
462	0.17
463	0.17
464	0.16
465	0.12
466	0.1
467	0.09
468	0.1
469	0.11
470	0.09
471	0.09
472	0.09
473	0.1
474	0.12
475	0.12
476	0.13
477	0.1
478	0.11
479	0.12
480	0.11
481	0.1
482	0.08
483	0.08
484	0.07
485	0.07
486	0.1
487	0.09
488	0.09
489	0.09
490	0.09

A0A1D8PK75

3D AlphaFold-predicted Structure Viewer