Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G3U1

Protein Details
Accession L8G3U1   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-93FKRLYHNTLKLQKKKKKKKKKKYYNHLYLPIRMBasic
NLS Segment(s)
PositionSequence
71-82LQKKKKKKKKKK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MLLSNPISLPTSITPPNLSELYTQVAQAGNIQDSMAISNFLNPVEESMVEDEEALNHDGFFKRLYHNTLKLQKKKKKKKKKKYYNHLYLPIRMLGML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.25
4 0.22
5 0.21
6 0.17
7 0.17
8 0.19
9 0.18
10 0.17
11 0.14
12 0.14
13 0.13
14 0.14
15 0.13
16 0.1
17 0.09
18 0.09
19 0.08
20 0.08
21 0.08
22 0.07
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.07
41 0.07
42 0.06
43 0.06
44 0.07
45 0.08
46 0.08
47 0.1
48 0.1
49 0.12
50 0.15
51 0.21
52 0.25
53 0.3
54 0.38
55 0.47
56 0.55
57 0.61
58 0.69
59 0.73
60 0.78
61 0.85
62 0.88
63 0.9
64 0.92
65 0.94
66 0.95
67 0.97
68 0.97
69 0.97
70 0.97
71 0.96
72 0.95
73 0.93
74 0.87
75 0.8
76 0.72
77 0.62