Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PIE5

Protein Details
Accession A0A1D8PIE5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
64-85LNSNYKFKPKPRPKPKSSPEPEHydrophilic
NLS Segment(s)
PositionSequence
71-80KPKPRPKPKS
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
KEGG cal:CAALFM_C209110CA  -  
Amino Acid Sequences MNCLIKDFLKLPLIREELIDAHPHFIALLRRPHLDSNFGQRIFNGDYLKKNFDRQEFENNRHMLNSNYKFKPKPRPKPKSSPEPEPEPEPEPEPEPKVKEISLDNIEFASFGNANASVRPHSGARSHGARPHGARTFVVDEYDTVPLSMNLNCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.29
4 0.25
5 0.25
6 0.27
7 0.2
8 0.19
9 0.18
10 0.17
11 0.15
12 0.16
13 0.19
14 0.2
15 0.26
16 0.27
17 0.29
18 0.32
19 0.37
20 0.35
21 0.36
22 0.33
23 0.36
24 0.41
25 0.39
26 0.37
27 0.32
28 0.35
29 0.32
30 0.33
31 0.26
32 0.21
33 0.27
34 0.3
35 0.36
36 0.33
37 0.35
38 0.36
39 0.38
40 0.41
41 0.38
42 0.46
43 0.46
44 0.5
45 0.52
46 0.48
47 0.44
48 0.39
49 0.36
50 0.27
51 0.31
52 0.33
53 0.33
54 0.34
55 0.38
56 0.4
57 0.45
58 0.54
59 0.55
60 0.61
61 0.64
62 0.72
63 0.75
64 0.84
65 0.85
66 0.84
67 0.79
68 0.77
69 0.7
70 0.67
71 0.61
72 0.54
73 0.49
74 0.41
75 0.37
76 0.29
77 0.26
78 0.21
79 0.22
80 0.22
81 0.22
82 0.22
83 0.22
84 0.22
85 0.21
86 0.21
87 0.2
88 0.22
89 0.23
90 0.21
91 0.2
92 0.18
93 0.18
94 0.15
95 0.14
96 0.11
97 0.07
98 0.07
99 0.07
100 0.08
101 0.08
102 0.09
103 0.11
104 0.1
105 0.11
106 0.13
107 0.13
108 0.15
109 0.17
110 0.19
111 0.23
112 0.27
113 0.29
114 0.32
115 0.34
116 0.37
117 0.37
118 0.42
119 0.41
120 0.38
121 0.35
122 0.36
123 0.37
124 0.32
125 0.31
126 0.24
127 0.2
128 0.21
129 0.22
130 0.17
131 0.13
132 0.13
133 0.12
134 0.14