Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FZH7

Protein Details
Accession L8FZH7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-78RTLIFYDRSSRKRRRRPPKGRAKKRIQYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
53-68SRKRRRRPPKGRAKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKRFERDDFGSFDDIMDGLRREYSNRTLIFYDRSSRKRRRRPPKGRAKKRIQYTRRFVNVTLTGGKRKMNPNPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.53
4 0.56
5 0.6
6 0.69
7 0.69
8 0.72
9 0.67
10 0.64
11 0.59
12 0.54
13 0.5
14 0.43
15 0.39
16 0.31
17 0.28
18 0.22
19 0.15
20 0.12
21 0.1
22 0.07
23 0.06
24 0.07
25 0.07
26 0.09
27 0.12
28 0.16
29 0.2
30 0.2
31 0.22
32 0.22
33 0.23
34 0.24
35 0.22
36 0.25
37 0.26
38 0.32
39 0.39
40 0.49
41 0.58
42 0.66
43 0.75
44 0.8
45 0.85
46 0.9
47 0.92
48 0.94
49 0.95
50 0.95
51 0.95
52 0.94
53 0.91
54 0.91
55 0.91
56 0.88
57 0.87
58 0.84
59 0.84
60 0.8
61 0.74
62 0.64
63 0.61
64 0.55
65 0.48
66 0.47
67 0.4
68 0.38
69 0.38
70 0.41
71 0.39
72 0.44
73 0.5