Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G0W0

Protein Details
Accession L8G0W0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-38IGAKTWRRKTPQKYASRRSNEIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 9.5, cyto 8.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MIGPVRHAQLQDEGGFIGAKTWRRKTPQKYASRRSNEIVIKPGLKSFALVRAAEDGVSCSTLRQPNGSRRGTISVSTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.11
5 0.11
6 0.17
7 0.23
8 0.28
9 0.33
10 0.41
11 0.51
12 0.57
13 0.65
14 0.69
15 0.73
16 0.78
17 0.81
18 0.84
19 0.81
20 0.76
21 0.67
22 0.64
23 0.57
24 0.48
25 0.42
26 0.34
27 0.28
28 0.25
29 0.23
30 0.17
31 0.14
32 0.13
33 0.1
34 0.15
35 0.16
36 0.16
37 0.16
38 0.17
39 0.17
40 0.16
41 0.15
42 0.11
43 0.09
44 0.1
45 0.1
46 0.08
47 0.13
48 0.18
49 0.19
50 0.23
51 0.3
52 0.38
53 0.47
54 0.49
55 0.46
56 0.45
57 0.5
58 0.46
59 0.42