Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8GBU9

Protein Details
Accession L8GBU9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-50IAWGERKRKRFDIKPRSRGENLBasic
NLS Segment(s)
PositionSequence
34-44RKRKRFDIKPR
Subcellular Location(s) nucl 11, cyto_nucl 9.833, cyto 6.5, cyto_mito 5.166, pero 3, mito 2.5
Family & Domain DBs
Amino Acid Sequences MKPLLRLVEEIRHGIPSHYHVDLENRLAIAWGERKRKRFDIKPRSRGENLVATRENRARIIYLQAQDEDCLLFLAFILAYSPRSCVDFKTTEFVELHDYALDNKQQRASPEPEKLLKTMAIRRGFNQNLHYLNYMQRMFPEGFVNTILCFLLVSATFAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.22
4 0.24
5 0.21
6 0.21
7 0.2
8 0.25
9 0.26
10 0.26
11 0.23
12 0.19
13 0.18
14 0.18
15 0.17
16 0.15
17 0.2
18 0.24
19 0.33
20 0.38
21 0.44
22 0.51
23 0.59
24 0.65
25 0.68
26 0.72
27 0.73
28 0.79
29 0.83
30 0.83
31 0.81
32 0.74
33 0.67
34 0.59
35 0.57
36 0.47
37 0.43
38 0.4
39 0.33
40 0.36
41 0.36
42 0.33
43 0.25
44 0.24
45 0.2
46 0.18
47 0.22
48 0.22
49 0.22
50 0.21
51 0.21
52 0.21
53 0.19
54 0.18
55 0.13
56 0.08
57 0.07
58 0.05
59 0.04
60 0.03
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.05
68 0.06
69 0.06
70 0.08
71 0.08
72 0.09
73 0.14
74 0.16
75 0.17
76 0.2
77 0.2
78 0.2
79 0.2
80 0.2
81 0.19
82 0.17
83 0.16
84 0.12
85 0.12
86 0.11
87 0.13
88 0.16
89 0.14
90 0.15
91 0.18
92 0.19
93 0.21
94 0.26
95 0.3
96 0.32
97 0.36
98 0.4
99 0.41
100 0.41
101 0.4
102 0.36
103 0.32
104 0.31
105 0.31
106 0.35
107 0.36
108 0.36
109 0.38
110 0.46
111 0.45
112 0.45
113 0.42
114 0.4
115 0.36
116 0.38
117 0.38
118 0.3
119 0.3
120 0.34
121 0.31
122 0.25
123 0.23
124 0.25
125 0.24
126 0.24
127 0.24
128 0.17
129 0.18
130 0.19
131 0.19
132 0.15
133 0.15
134 0.13
135 0.09
136 0.08
137 0.07
138 0.08
139 0.08
140 0.09