Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FLU5

Protein Details
Accession L8FLU5    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-53DDEDVRPPRRRKRRDTTEQEGWPBasic
NLS Segment(s)
PositionSequence
37-44PPRRRKRR
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MEDESIAVAPLSQDREHSVKSYHKDSEDNEDDEDVRPPRRRKRRDTTEQEGWPTTGQEGGRSHETGPGTWRGSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.21
4 0.23
5 0.25
6 0.28
7 0.33
8 0.37
9 0.36
10 0.35
11 0.37
12 0.37
13 0.41
14 0.39
15 0.36
16 0.3
17 0.28
18 0.26
19 0.24
20 0.25
21 0.17
22 0.17
23 0.23
24 0.29
25 0.38
26 0.48
27 0.56
28 0.62
29 0.72
30 0.78
31 0.82
32 0.85
33 0.84
34 0.82
35 0.78
36 0.71
37 0.61
38 0.52
39 0.41
40 0.32
41 0.24
42 0.18
43 0.15
44 0.16
45 0.16
46 0.2
47 0.23
48 0.23
49 0.23
50 0.25
51 0.26
52 0.22
53 0.25
54 0.27
55 0.26