Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G9C7

Protein Details
Accession L8G9C7    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
12-37TPPVDRTEHPRRPHPNPPHPPPTPRHBasic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 10, cyto_nucl 7.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002129  PyrdxlP-dep_de-COase  
IPR015424  PyrdxlP-dep_Trfase  
IPR015421  PyrdxlP-dep_Trfase_major  
Gene Ontology GO:0016830  F:carbon-carbon lyase activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0019752  P:carboxylic acid metabolic process  
Pfam View protein in Pfam  
PF00282  Pyridoxal_deC  
Amino Acid Sequences MSSPISNETFTTPPVDRTEHPRRPHPNPPHPPPTPRHPPNTLTHLLTLPPAFSSPSLTPAFYAFVTGSTLPIAAAADNLATAIDCSVAVHDSRASLATTLEAHTLIMLTELLRLSPSVWGGRVITPGATGSNILAIATARDALLDRRLKARGRAETVASAGVVGACVQAGVRGMQILGAAAHSSVHKAAGVLGLGRGNVRDVGVKGEPWRLDLEKVRREAGREGWVSVVVVGMGEVNTGRYFGGEEEMAKLKGCLEECAPGAAWIHVDGAFGIFARSLPETEEFASLRAQSEGLQYADSITADCHKALNVPYASAVLLTRSETNLNNVCNNGAAAYLKTSATDPHPFPPQPRLGELAPLQRSAYLCRAPRAWARGSGPVVCYAGASREGGGKYDSGARGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.31
4 0.39
5 0.49
6 0.52
7 0.57
8 0.63
9 0.67
10 0.71
11 0.79
12 0.8
13 0.8
14 0.82
15 0.85
16 0.85
17 0.82
18 0.83
19 0.78
20 0.77
21 0.77
22 0.74
23 0.72
24 0.69
25 0.68
26 0.67
27 0.69
28 0.64
29 0.55
30 0.5
31 0.43
32 0.38
33 0.35
34 0.28
35 0.2
36 0.17
37 0.15
38 0.13
39 0.12
40 0.17
41 0.15
42 0.2
43 0.21
44 0.21
45 0.2
46 0.2
47 0.22
48 0.16
49 0.17
50 0.11
51 0.1
52 0.13
53 0.12
54 0.11
55 0.1
56 0.1
57 0.08
58 0.08
59 0.08
60 0.05
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.06
76 0.07
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.09
85 0.09
86 0.1
87 0.1
88 0.09
89 0.08
90 0.08
91 0.08
92 0.06
93 0.06
94 0.05
95 0.04
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.08
103 0.1
104 0.09
105 0.1
106 0.11
107 0.12
108 0.13
109 0.14
110 0.13
111 0.11
112 0.11
113 0.1
114 0.1
115 0.08
116 0.07
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.05
129 0.06
130 0.14
131 0.16
132 0.17
133 0.21
134 0.25
135 0.27
136 0.33
137 0.39
138 0.38
139 0.4
140 0.41
141 0.39
142 0.36
143 0.35
144 0.28
145 0.21
146 0.15
147 0.09
148 0.07
149 0.05
150 0.04
151 0.03
152 0.02
153 0.03
154 0.02
155 0.03
156 0.03
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.06
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.09
190 0.09
191 0.1
192 0.12
193 0.15
194 0.15
195 0.15
196 0.17
197 0.14
198 0.17
199 0.22
200 0.28
201 0.29
202 0.31
203 0.32
204 0.31
205 0.33
206 0.32
207 0.3
208 0.29
209 0.25
210 0.24
211 0.21
212 0.21
213 0.18
214 0.16
215 0.12
216 0.05
217 0.04
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.04
225 0.04
226 0.04
227 0.04
228 0.05
229 0.05
230 0.07
231 0.06
232 0.07
233 0.09
234 0.11
235 0.11
236 0.11
237 0.1
238 0.1
239 0.12
240 0.12
241 0.11
242 0.1
243 0.13
244 0.13
245 0.14
246 0.13
247 0.11
248 0.11
249 0.1
250 0.09
251 0.07
252 0.08
253 0.07
254 0.06
255 0.06
256 0.06
257 0.05
258 0.05
259 0.05
260 0.04
261 0.04
262 0.06
263 0.06
264 0.06
265 0.08
266 0.1
267 0.12
268 0.13
269 0.15
270 0.14
271 0.14
272 0.15
273 0.14
274 0.13
275 0.12
276 0.11
277 0.09
278 0.11
279 0.13
280 0.12
281 0.12
282 0.11
283 0.11
284 0.11
285 0.11
286 0.09
287 0.07
288 0.09
289 0.1
290 0.11
291 0.1
292 0.1
293 0.13
294 0.14
295 0.21
296 0.19
297 0.18
298 0.19
299 0.19
300 0.19
301 0.16
302 0.14
303 0.08
304 0.08
305 0.09
306 0.1
307 0.11
308 0.14
309 0.14
310 0.2
311 0.24
312 0.25
313 0.25
314 0.25
315 0.24
316 0.21
317 0.21
318 0.15
319 0.11
320 0.1
321 0.09
322 0.1
323 0.11
324 0.11
325 0.11
326 0.12
327 0.14
328 0.18
329 0.24
330 0.24
331 0.27
332 0.35
333 0.36
334 0.39
335 0.45
336 0.47
337 0.44
338 0.44
339 0.44
340 0.37
341 0.41
342 0.42
343 0.42
344 0.37
345 0.35
346 0.33
347 0.31
348 0.31
349 0.3
350 0.32
351 0.31
352 0.32
353 0.35
354 0.37
355 0.39
356 0.46
357 0.47
358 0.44
359 0.44
360 0.45
361 0.48
362 0.5
363 0.47
364 0.42
365 0.39
366 0.36
367 0.29
368 0.26
369 0.19
370 0.18
371 0.16
372 0.16
373 0.13
374 0.18
375 0.18
376 0.19
377 0.2
378 0.17
379 0.18
380 0.24