Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G6C4

Protein Details
Accession L8G6C4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-113ITKARGKGPPKKKRTAAESKKLKGKKKVTTDEABasic
NLS Segment(s)
PositionSequence
83-107KARGKGPPKKKRTAAESKKLKGKKK
Subcellular Location(s) mito 18.5, cyto_mito 10.833, nucl 5.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVARSRVIDLMKTRCRIFSTTFNPEGVRTGNKILRQRLKGPALAAYYPRKVVTINDLRKAYPELKTWDEKEEDRLESVAITKARGKGPPKKKRTAAESKKLKGKKKVTTDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.44
4 0.43
5 0.41
6 0.42
7 0.42
8 0.46
9 0.47
10 0.46
11 0.43
12 0.4
13 0.37
14 0.3
15 0.24
16 0.18
17 0.22
18 0.24
19 0.29
20 0.35
21 0.41
22 0.46
23 0.48
24 0.51
25 0.53
26 0.53
27 0.49
28 0.44
29 0.39
30 0.33
31 0.3
32 0.29
33 0.25
34 0.22
35 0.22
36 0.21
37 0.17
38 0.15
39 0.15
40 0.2
41 0.26
42 0.28
43 0.32
44 0.33
45 0.32
46 0.33
47 0.35
48 0.29
49 0.23
50 0.23
51 0.22
52 0.25
53 0.29
54 0.3
55 0.3
56 0.31
57 0.28
58 0.3
59 0.29
60 0.26
61 0.23
62 0.22
63 0.18
64 0.16
65 0.16
66 0.15
67 0.12
68 0.13
69 0.15
70 0.19
71 0.22
72 0.27
73 0.33
74 0.39
75 0.5
76 0.59
77 0.65
78 0.7
79 0.76
80 0.78
81 0.8
82 0.82
83 0.81
84 0.81
85 0.83
86 0.81
87 0.83
88 0.83
89 0.82
90 0.81
91 0.8
92 0.79
93 0.8