Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FPL6

Protein Details
Accession L8FPL6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MIKVCDRHRRRRRKARLAAVFRAPNHydrophilic
27-52NFPFKLKSKKCTTPHRLSQPPPQPTRHydrophilic
NLS Segment(s)
PositionSequence
8-17HRRRRRKARL
Subcellular Location(s) mito 17, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012336  Thioredoxin-like_fold  
Pfam View protein in Pfam  
PF17172  GST_N_4  
Amino Acid Sequences MIKVCDRHRRRRRKARLAAVFRAPNVNFPFKLKSKKCTTPHRLSQPPPQPTRGPYRNNAVITSTTVLHLLTKRRTIQLLPINRHRNRNPPHPPPHPLHHPPPPPAPSSTSSPCTPTPPTPSPLRSPSPSPLPTLHIFTSPSSPTAPSPNPTCLKHQTALRLASLPHTTTNSTNHASPTGALPFLLPPTSSPLLPAALLPVGAGQILSYATKAGHPLPARPAHPKAKVYASLIDDAIRPAWLHAVYLTPANAHLPTRLYLAPATSSWLVQTYQGISLRRAASEQLKIAAPGEWWM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.95
3 0.95
4 0.93
5 0.88
6 0.86
7 0.78
8 0.68
9 0.65
10 0.54
11 0.51
12 0.48
13 0.46
14 0.38
15 0.38
16 0.45
17 0.44
18 0.54
19 0.52
20 0.55
21 0.58
22 0.67
23 0.72
24 0.76
25 0.79
26 0.79
27 0.84
28 0.85
29 0.85
30 0.81
31 0.82
32 0.81
33 0.8
34 0.75
35 0.7
36 0.63
37 0.59
38 0.64
39 0.62
40 0.59
41 0.54
42 0.58
43 0.6
44 0.57
45 0.53
46 0.45
47 0.38
48 0.34
49 0.31
50 0.23
51 0.16
52 0.15
53 0.14
54 0.14
55 0.16
56 0.2
57 0.23
58 0.28
59 0.3
60 0.33
61 0.35
62 0.33
63 0.39
64 0.41
65 0.45
66 0.46
67 0.53
68 0.61
69 0.63
70 0.7
71 0.65
72 0.67
73 0.65
74 0.69
75 0.69
76 0.69
77 0.74
78 0.72
79 0.74
80 0.69
81 0.69
82 0.67
83 0.64
84 0.6
85 0.6
86 0.59
87 0.57
88 0.59
89 0.55
90 0.48
91 0.43
92 0.41
93 0.35
94 0.35
95 0.35
96 0.32
97 0.29
98 0.31
99 0.3
100 0.29
101 0.3
102 0.27
103 0.32
104 0.31
105 0.34
106 0.35
107 0.37
108 0.39
109 0.41
110 0.41
111 0.35
112 0.36
113 0.36
114 0.38
115 0.36
116 0.34
117 0.3
118 0.3
119 0.29
120 0.29
121 0.26
122 0.2
123 0.2
124 0.18
125 0.19
126 0.16
127 0.15
128 0.13
129 0.13
130 0.12
131 0.16
132 0.17
133 0.16
134 0.18
135 0.23
136 0.26
137 0.27
138 0.31
139 0.31
140 0.33
141 0.34
142 0.33
143 0.33
144 0.34
145 0.34
146 0.3
147 0.26
148 0.23
149 0.22
150 0.21
151 0.17
152 0.13
153 0.13
154 0.14
155 0.15
156 0.17
157 0.19
158 0.19
159 0.19
160 0.19
161 0.18
162 0.17
163 0.16
164 0.14
165 0.12
166 0.1
167 0.09
168 0.09
169 0.08
170 0.09
171 0.09
172 0.07
173 0.06
174 0.12
175 0.14
176 0.13
177 0.13
178 0.14
179 0.14
180 0.14
181 0.13
182 0.08
183 0.07
184 0.07
185 0.06
186 0.05
187 0.05
188 0.04
189 0.04
190 0.03
191 0.03
192 0.04
193 0.04
194 0.04
195 0.05
196 0.05
197 0.06
198 0.08
199 0.08
200 0.14
201 0.15
202 0.18
203 0.24
204 0.29
205 0.31
206 0.36
207 0.43
208 0.45
209 0.5
210 0.49
211 0.46
212 0.47
213 0.48
214 0.44
215 0.43
216 0.37
217 0.33
218 0.31
219 0.28
220 0.22
221 0.2
222 0.17
223 0.12
224 0.1
225 0.08
226 0.11
227 0.1
228 0.1
229 0.1
230 0.11
231 0.11
232 0.13
233 0.13
234 0.1
235 0.11
236 0.12
237 0.13
238 0.12
239 0.13
240 0.14
241 0.15
242 0.18
243 0.18
244 0.18
245 0.17
246 0.18
247 0.18
248 0.16
249 0.2
250 0.17
251 0.17
252 0.15
253 0.17
254 0.16
255 0.15
256 0.17
257 0.14
258 0.18
259 0.23
260 0.24
261 0.23
262 0.29
263 0.3
264 0.28
265 0.28
266 0.27
267 0.29
268 0.33
269 0.34
270 0.3
271 0.3
272 0.29
273 0.29
274 0.26