Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FQR5

Protein Details
Accession L8FQR5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGPKKAKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
8-23PKKAKKKWSKGKVKDK
Subcellular Location(s) cyto 11.5, cyto_nucl 10, nucl 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGPKKAKKKWSKGKVKDKAQHAVLLDKATSDKLYKDVQTYRLITVAVLVDRMKINGSVARRCLADLEEKGIIKKVVSHSALSIYTRAITADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.91
4 0.91
5 0.94
6 0.93
7 0.93
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.14
26 0.15
27 0.18
28 0.2
29 0.23
30 0.27
31 0.27
32 0.25
33 0.23
34 0.22
35 0.17
36 0.15
37 0.12
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.14
49 0.16
50 0.17
51 0.19
52 0.19
53 0.19
54 0.19
55 0.17
56 0.2
57 0.17
58 0.2
59 0.21
60 0.21
61 0.22
62 0.23
63 0.22
64 0.16
65 0.2
66 0.2
67 0.25
68 0.26
69 0.27
70 0.26
71 0.29
72 0.31
73 0.27
74 0.24
75 0.17
76 0.16
77 0.15