Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FWB3

Protein Details
Accession L8FWB3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-88GARRWWCCGRGKRTRVQPDYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 4, extr 4, cyto 3.5, cyto_nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007568  RTA1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04479  RTA1  
Amino Acid Sequences MASITIHIIFRLVEFSSGLYGPIPTHESYFYGLEATPMFLALFSLAAIHPGCYLRGPGSEFAKPIVTKGARRWWCCGRGKRTRVQPDYDTPKREWGVQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.11
5 0.11
6 0.09
7 0.09
8 0.08
9 0.1
10 0.12
11 0.11
12 0.12
13 0.13
14 0.13
15 0.15
16 0.16
17 0.14
18 0.12
19 0.11
20 0.11
21 0.1
22 0.09
23 0.07
24 0.06
25 0.06
26 0.05
27 0.05
28 0.04
29 0.04
30 0.03
31 0.04
32 0.03
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.08
43 0.09
44 0.11
45 0.14
46 0.15
47 0.15
48 0.16
49 0.19
50 0.17
51 0.16
52 0.21
53 0.2
54 0.22
55 0.27
56 0.36
57 0.4
58 0.43
59 0.49
60 0.49
61 0.55
62 0.62
63 0.66
64 0.66
65 0.69
66 0.73
67 0.76
68 0.79
69 0.81
70 0.77
71 0.75
72 0.71
73 0.7
74 0.74
75 0.73
76 0.67
77 0.58
78 0.61
79 0.56