Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FU57

Protein Details
Accession L8FU57    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-80AELKSTEKRPRGRPRKRPIEEVDBasic
NLS Segment(s)
PositionSequence
64-75EKRPRGRPRKRP
Subcellular Location(s) nucl 20, cyto_nucl 13, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MTRLVESQNAELSILRKEVKEYKEILETRKKRTTGKRIKLQGEFVFSTEEVLKIVREAELKSTEKRPRGRPRKRPIEEVDEEVEEEEVENDSSDPELELEDTLYCYKAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.2
5 0.27
6 0.28
7 0.31
8 0.31
9 0.31
10 0.38
11 0.4
12 0.42
13 0.46
14 0.48
15 0.51
16 0.56
17 0.56
18 0.56
19 0.64
20 0.69
21 0.69
22 0.74
23 0.76
24 0.76
25 0.8
26 0.75
27 0.7
28 0.61
29 0.55
30 0.45
31 0.36
32 0.3
33 0.23
34 0.21
35 0.15
36 0.13
37 0.08
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.09
46 0.14
47 0.16
48 0.18
49 0.26
50 0.31
51 0.37
52 0.43
53 0.5
54 0.57
55 0.66
56 0.75
57 0.78
58 0.83
59 0.88
60 0.86
61 0.85
62 0.79
63 0.77
64 0.69
65 0.63
66 0.54
67 0.43
68 0.39
69 0.3
70 0.24
71 0.15
72 0.12
73 0.08
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.06
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.1
89 0.1