Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FSR6

Protein Details
Accession L8FSR6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AQTPQQRKSNQKFAKENRAKMHydrophilic
NLS Segment(s)
PositionSequence
19-24RAKMGK
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAQTPQQRKSNQKFAKENRAKMGKPEGTLKKKQQTFKSPVSPTWLGSSNHYIPIALHLLIRPLSSPFSIRGVRWSDIRVNFEGILQINEADQGGGEIDTRGKRNVAISNKMRDPNFKLHSVPNIISQAQFNIRIED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.83
4 0.79
5 0.78
6 0.78
7 0.69
8 0.64
9 0.66
10 0.58
11 0.52
12 0.55
13 0.56
14 0.56
15 0.63
16 0.66
17 0.65
18 0.68
19 0.73
20 0.72
21 0.72
22 0.72
23 0.72
24 0.72
25 0.66
26 0.61
27 0.61
28 0.53
29 0.44
30 0.4
31 0.36
32 0.28
33 0.28
34 0.32
35 0.26
36 0.26
37 0.25
38 0.22
39 0.17
40 0.18
41 0.17
42 0.11
43 0.1
44 0.08
45 0.1
46 0.1
47 0.1
48 0.08
49 0.07
50 0.08
51 0.08
52 0.09
53 0.09
54 0.13
55 0.14
56 0.14
57 0.18
58 0.2
59 0.21
60 0.21
61 0.22
62 0.24
63 0.25
64 0.29
65 0.25
66 0.22
67 0.21
68 0.2
69 0.2
70 0.14
71 0.12
72 0.09
73 0.08
74 0.07
75 0.07
76 0.06
77 0.05
78 0.04
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.07
85 0.1
86 0.12
87 0.13
88 0.13
89 0.14
90 0.18
91 0.26
92 0.29
93 0.36
94 0.41
95 0.47
96 0.52
97 0.56
98 0.54
99 0.52
100 0.52
101 0.52
102 0.51
103 0.47
104 0.44
105 0.43
106 0.48
107 0.48
108 0.43
109 0.39
110 0.38
111 0.36
112 0.34
113 0.3
114 0.28
115 0.27
116 0.29