Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FY60

Protein Details
Accession L8FY60    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
168-190KEDKKGKGGWRRRSWSRCWRRLVBasic
NLS Segment(s)
PositionSequence
171-180KKGKGGWRRR
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPATTRRTRGAPPAKGAQSTLSFNGAATRVTKHTGPAGKDLKKAEPAKPAKVDVIDLDRADDAVVEAEVQTPPQVQLPKPESALTPEEEKAEKVPHSQVLRYWKAKEAERLAPRVHQEGLSTEEKILRYFDMSSQYGPCVGIPRRKRWLRAHRLGLAPPIETLAVLVKEDKKGKGGWRRRSWSRCWRRLVGTFEFCWGLLRGGFEALGVGFCWSDIDGIWLVYWRLHLYRYLGRGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.54
4 0.48
5 0.41
6 0.38
7 0.34
8 0.27
9 0.23
10 0.22
11 0.24
12 0.2
13 0.17
14 0.15
15 0.17
16 0.17
17 0.2
18 0.2
19 0.19
20 0.26
21 0.31
22 0.32
23 0.38
24 0.44
25 0.46
26 0.5
27 0.51
28 0.48
29 0.51
30 0.53
31 0.49
32 0.5
33 0.51
34 0.53
35 0.54
36 0.51
37 0.45
38 0.42
39 0.38
40 0.3
41 0.29
42 0.25
43 0.21
44 0.2
45 0.17
46 0.16
47 0.15
48 0.12
49 0.08
50 0.05
51 0.05
52 0.04
53 0.04
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.1
61 0.13
62 0.13
63 0.21
64 0.25
65 0.27
66 0.27
67 0.28
68 0.24
69 0.25
70 0.27
71 0.2
72 0.2
73 0.18
74 0.19
75 0.18
76 0.18
77 0.16
78 0.17
79 0.16
80 0.15
81 0.16
82 0.2
83 0.21
84 0.21
85 0.23
86 0.29
87 0.34
88 0.35
89 0.35
90 0.35
91 0.36
92 0.38
93 0.41
94 0.37
95 0.39
96 0.39
97 0.41
98 0.36
99 0.35
100 0.34
101 0.31
102 0.26
103 0.18
104 0.16
105 0.14
106 0.18
107 0.16
108 0.15
109 0.13
110 0.15
111 0.15
112 0.15
113 0.14
114 0.09
115 0.09
116 0.1
117 0.11
118 0.14
119 0.14
120 0.15
121 0.15
122 0.15
123 0.14
124 0.14
125 0.12
126 0.13
127 0.16
128 0.23
129 0.27
130 0.34
131 0.43
132 0.47
133 0.55
134 0.6
135 0.68
136 0.7
137 0.75
138 0.75
139 0.71
140 0.7
141 0.63
142 0.56
143 0.46
144 0.36
145 0.26
146 0.2
147 0.14
148 0.11
149 0.1
150 0.08
151 0.07
152 0.07
153 0.09
154 0.11
155 0.15
156 0.19
157 0.19
158 0.2
159 0.23
160 0.31
161 0.39
162 0.47
163 0.54
164 0.61
165 0.68
166 0.76
167 0.79
168 0.81
169 0.81
170 0.83
171 0.81
172 0.78
173 0.76
174 0.73
175 0.73
176 0.71
177 0.67
178 0.61
179 0.53
180 0.48
181 0.42
182 0.35
183 0.3
184 0.24
185 0.17
186 0.13
187 0.14
188 0.12
189 0.12
190 0.12
191 0.09
192 0.09
193 0.08
194 0.07
195 0.06
196 0.06
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.05
203 0.08
204 0.08
205 0.09
206 0.09
207 0.1
208 0.1
209 0.1
210 0.12
211 0.12
212 0.13
213 0.14
214 0.17
215 0.21
216 0.28
217 0.31