Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G9B8

Protein Details
Accession L8G9B8    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
161-182EFERRDKERKGKVEERERHRRABasic
NLS Segment(s)
PositionSequence
36-61RRKVIKIKKDLIHNAKVKKSYAKIKA
130-198PKTARAKKPGYFDKAKAEADVKRKEAEERRAEFERRDKERKGKVEERERHRRAMAKARTGGRNGQRKLG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPKRDREDDPQVPHVKKTRAGFKVGPDNLPDGTWRRKVIKIKKDLIHNAKVKKSYAKIKARTSPPPTPAAPDASTIVIQAPSEPVAPTPVEPKQEREGEGDRELHPSRQAMLDAPDAPPAASVPRFSGPKTARAKKPGYFDKAKAEADVKRKEAEERRAEFERRDKERKGKVEERERHRRAMAKARTGGRNGQRKLGRESVVLLDKVRRMVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.59
4 0.56
5 0.56
6 0.57
7 0.53
8 0.58
9 0.55
10 0.55
11 0.61
12 0.57
13 0.52
14 0.44
15 0.43
16 0.37
17 0.33
18 0.29
19 0.24
20 0.27
21 0.3
22 0.32
23 0.34
24 0.41
25 0.5
26 0.58
27 0.62
28 0.65
29 0.69
30 0.7
31 0.75
32 0.78
33 0.76
34 0.74
35 0.72
36 0.68
37 0.65
38 0.63
39 0.56
40 0.53
41 0.52
42 0.52
43 0.55
44 0.59
45 0.61
46 0.65
47 0.71
48 0.71
49 0.74
50 0.72
51 0.69
52 0.62
53 0.59
54 0.52
55 0.47
56 0.43
57 0.38
58 0.31
59 0.26
60 0.23
61 0.2
62 0.19
63 0.15
64 0.13
65 0.09
66 0.08
67 0.07
68 0.07
69 0.06
70 0.07
71 0.07
72 0.06
73 0.08
74 0.08
75 0.08
76 0.11
77 0.13
78 0.18
79 0.19
80 0.22
81 0.26
82 0.27
83 0.28
84 0.29
85 0.3
86 0.28
87 0.29
88 0.28
89 0.23
90 0.26
91 0.25
92 0.22
93 0.19
94 0.16
95 0.15
96 0.14
97 0.13
98 0.09
99 0.11
100 0.12
101 0.11
102 0.11
103 0.12
104 0.11
105 0.1
106 0.09
107 0.07
108 0.08
109 0.07
110 0.08
111 0.09
112 0.12
113 0.13
114 0.14
115 0.22
116 0.22
117 0.3
118 0.39
119 0.45
120 0.47
121 0.53
122 0.58
123 0.53
124 0.61
125 0.6
126 0.58
127 0.56
128 0.53
129 0.54
130 0.54
131 0.5
132 0.43
133 0.38
134 0.37
135 0.39
136 0.42
137 0.36
138 0.33
139 0.33
140 0.39
141 0.44
142 0.48
143 0.49
144 0.47
145 0.51
146 0.55
147 0.56
148 0.53
149 0.54
150 0.54
151 0.53
152 0.57
153 0.58
154 0.62
155 0.69
156 0.72
157 0.73
158 0.72
159 0.74
160 0.78
161 0.8
162 0.8
163 0.82
164 0.77
165 0.73
166 0.7
167 0.67
168 0.63
169 0.65
170 0.64
171 0.62
172 0.65
173 0.67
174 0.67
175 0.63
176 0.65
177 0.63
178 0.65
179 0.58
180 0.6
181 0.58
182 0.57
183 0.61
184 0.6
185 0.53
186 0.45
187 0.46
188 0.43
189 0.44
190 0.41
191 0.35
192 0.33
193 0.32