Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RLD4

Protein Details
Accession E3RLD4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRIQREHKKADKAGBasic
NLS Segment(s)
PositionSequence
8-24RIQREHKKADKAGTRAP
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
KEGG pte:PTT_09163  -  
Amino Acid Sequences MPISKKDRIQREHKKADKAGTRAPVKANGLPVKAPKPTSICQNCRREIVNTNKAQLEAHAASHDATLWPKEKCWPNDYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.79
4 0.76
5 0.69
6 0.65
7 0.63
8 0.58
9 0.52
10 0.5
11 0.46
12 0.41
13 0.38
14 0.38
15 0.32
16 0.3
17 0.29
18 0.31
19 0.29
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.55
30 0.54
31 0.51
32 0.52
33 0.45
34 0.45
35 0.47
36 0.48
37 0.43
38 0.44
39 0.42
40 0.4
41 0.37
42 0.3
43 0.26
44 0.18
45 0.17
46 0.15
47 0.14
48 0.14
49 0.14
50 0.14
51 0.09
52 0.1
53 0.13
54 0.16
55 0.17
56 0.18
57 0.27
58 0.35
59 0.4