Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RKL0

Protein Details
Accession E3RKL0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-62DPVRCERRTKIPSARRQQPLHydrophilic
111-133TTILKNRKKRLAARKTRDRMNLQHydrophilic
NLS Segment(s)
PositionSequence
116-127NRKKRLAARKTR
Subcellular Location(s) mito 16.5, cyto_mito 10.5, nucl 5, cyto 3.5
Family & Domain DBs
KEGG pte:PTT_08775  -  
Amino Acid Sequences MAMRRGQQRSSKLEELLPILLTIKGLDPNFSSTRAPGKPGHADPVRCERRTKIPSARRQQPLSTTHHVGHRRSTNTPFQFFELPQEIRDEVYSYLVVHQSSPRSPPILDATTILKNRKKRLAARKTRDRMNLQRLSDGKRPICPRTTNTEPILHMDLVRTSQRLAHEATDCMYTKNWFAISLSKLPQPTFEVPQGWDTSRIKRLQVEVQLKDAIRMNRYIDWASFFTAFPSLQFLRIVPTLHPRYYEWARLEFCDWASIPFVHKAFFRELLAAIPRHVDLTIGMPVDADLQIQGKVALEEKLLWDMYIELGNRVDGAGKLIPVSRVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.39
4 0.32
5 0.23
6 0.2
7 0.17
8 0.15
9 0.12
10 0.11
11 0.14
12 0.14
13 0.16
14 0.16
15 0.22
16 0.24
17 0.26
18 0.25
19 0.23
20 0.31
21 0.31
22 0.34
23 0.31
24 0.36
25 0.42
26 0.43
27 0.49
28 0.47
29 0.48
30 0.49
31 0.56
32 0.58
33 0.51
34 0.52
35 0.48
36 0.52
37 0.56
38 0.6
39 0.59
40 0.61
41 0.7
42 0.77
43 0.82
44 0.79
45 0.78
46 0.73
47 0.7
48 0.66
49 0.63
50 0.59
51 0.53
52 0.48
53 0.51
54 0.53
55 0.48
56 0.5
57 0.49
58 0.47
59 0.48
60 0.52
61 0.54
62 0.54
63 0.55
64 0.49
65 0.44
66 0.43
67 0.38
68 0.38
69 0.34
70 0.29
71 0.26
72 0.27
73 0.24
74 0.21
75 0.21
76 0.17
77 0.11
78 0.12
79 0.12
80 0.1
81 0.11
82 0.12
83 0.12
84 0.11
85 0.14
86 0.15
87 0.17
88 0.19
89 0.19
90 0.2
91 0.19
92 0.21
93 0.24
94 0.23
95 0.21
96 0.2
97 0.22
98 0.25
99 0.29
100 0.31
101 0.3
102 0.34
103 0.4
104 0.46
105 0.5
106 0.54
107 0.62
108 0.68
109 0.74
110 0.79
111 0.84
112 0.82
113 0.82
114 0.8
115 0.77
116 0.75
117 0.74
118 0.7
119 0.6
120 0.59
121 0.55
122 0.54
123 0.51
124 0.48
125 0.39
126 0.39
127 0.42
128 0.4
129 0.43
130 0.4
131 0.38
132 0.41
133 0.45
134 0.44
135 0.42
136 0.42
137 0.36
138 0.36
139 0.35
140 0.26
141 0.2
142 0.16
143 0.13
144 0.12
145 0.12
146 0.1
147 0.08
148 0.1
149 0.1
150 0.12
151 0.13
152 0.13
153 0.14
154 0.14
155 0.14
156 0.15
157 0.14
158 0.13
159 0.13
160 0.11
161 0.1
162 0.11
163 0.11
164 0.08
165 0.09
166 0.12
167 0.14
168 0.17
169 0.19
170 0.2
171 0.21
172 0.21
173 0.22
174 0.22
175 0.22
176 0.21
177 0.21
178 0.21
179 0.2
180 0.23
181 0.23
182 0.19
183 0.22
184 0.21
185 0.23
186 0.28
187 0.29
188 0.28
189 0.29
190 0.31
191 0.31
192 0.38
193 0.41
194 0.36
195 0.37
196 0.39
197 0.36
198 0.35
199 0.34
200 0.27
201 0.21
202 0.22
203 0.22
204 0.21
205 0.23
206 0.23
207 0.19
208 0.2
209 0.19
210 0.19
211 0.18
212 0.16
213 0.14
214 0.15
215 0.14
216 0.11
217 0.15
218 0.14
219 0.14
220 0.14
221 0.13
222 0.15
223 0.17
224 0.18
225 0.14
226 0.24
227 0.27
228 0.28
229 0.3
230 0.27
231 0.33
232 0.36
233 0.41
234 0.34
235 0.35
236 0.36
237 0.35
238 0.36
239 0.31
240 0.27
241 0.23
242 0.2
243 0.16
244 0.17
245 0.16
246 0.17
247 0.2
248 0.2
249 0.18
250 0.19
251 0.21
252 0.23
253 0.24
254 0.23
255 0.2
256 0.2
257 0.22
258 0.25
259 0.22
260 0.19
261 0.18
262 0.17
263 0.17
264 0.16
265 0.13
266 0.09
267 0.11
268 0.14
269 0.13
270 0.12
271 0.11
272 0.11
273 0.13
274 0.12
275 0.09
276 0.07
277 0.08
278 0.08
279 0.08
280 0.09
281 0.08
282 0.09
283 0.1
284 0.1
285 0.1
286 0.11
287 0.12
288 0.15
289 0.15
290 0.13
291 0.12
292 0.12
293 0.12
294 0.15
295 0.14
296 0.13
297 0.13
298 0.13
299 0.13
300 0.13
301 0.13
302 0.09
303 0.13
304 0.13
305 0.12
306 0.14
307 0.16
308 0.17