Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G9K3

Protein Details
Accession L8G9K3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-140GSPRSRNHIRETRQRARRRRTHRNVKMRLQLPAHydrophilic
NLS Segment(s)
PositionSequence
111-131RSRNHIRETRQRARRRRTHRN
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MAVRLYHRMRYSAIVRTASKLQGTDEMMEWGHRAISLPYPCHISRDKTSSSPPRGAKPRRFESLSASKDLTLPRTEHVFLLAARTNPIPVGSCTFCNPHMESRSHSHGSPRSRNHIRETRQRARRRRTHRNVKMRLQLPACRSVVGAGCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.41
4 0.43
5 0.4
6 0.37
7 0.3
8 0.26
9 0.26
10 0.26
11 0.24
12 0.21
13 0.19
14 0.18
15 0.18
16 0.16
17 0.11
18 0.09
19 0.08
20 0.08
21 0.08
22 0.14
23 0.18
24 0.19
25 0.2
26 0.25
27 0.25
28 0.28
29 0.3
30 0.29
31 0.3
32 0.34
33 0.36
34 0.34
35 0.42
36 0.47
37 0.49
38 0.51
39 0.49
40 0.51
41 0.58
42 0.64
43 0.64
44 0.64
45 0.64
46 0.63
47 0.63
48 0.55
49 0.53
50 0.54
51 0.48
52 0.41
53 0.36
54 0.31
55 0.3
56 0.3
57 0.24
58 0.16
59 0.15
60 0.13
61 0.16
62 0.16
63 0.13
64 0.14
65 0.12
66 0.1
67 0.13
68 0.14
69 0.11
70 0.12
71 0.12
72 0.11
73 0.1
74 0.11
75 0.09
76 0.08
77 0.12
78 0.12
79 0.13
80 0.15
81 0.16
82 0.17
83 0.19
84 0.2
85 0.22
86 0.25
87 0.26
88 0.28
89 0.32
90 0.38
91 0.36
92 0.35
93 0.36
94 0.38
95 0.45
96 0.5
97 0.5
98 0.53
99 0.59
100 0.62
101 0.65
102 0.68
103 0.66
104 0.68
105 0.73
106 0.73
107 0.76
108 0.82
109 0.83
110 0.85
111 0.87
112 0.87
113 0.88
114 0.89
115 0.91
116 0.92
117 0.93
118 0.92
119 0.91
120 0.9
121 0.83
122 0.8
123 0.74
124 0.7
125 0.63
126 0.61
127 0.53
128 0.43
129 0.39
130 0.34