Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G2S1

Protein Details
Accession L8G2S1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-33NSGFKLPRRQPIDQRPPRRPQTNIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013880  Yos1  
Gene Ontology GO:0016020  C:membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF08571  Yos1  
Amino Acid Sequences MWGRKFPHQNSGFKLPRRQPIDQRPPRRPQTNIHPPSEPASFSGEKLRTDKMMFFGLGGVFYFLVLVTNAIAILSEDRFLARIGWSASSAAEPAFGAGPGGDASVKSKIVNLIASVRTLMRIPLIGINLLVIVYELILG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.67
3 0.69
4 0.7
5 0.7
6 0.7
7 0.74
8 0.79
9 0.8
10 0.82
11 0.82
12 0.85
13 0.87
14 0.83
15 0.75
16 0.71
17 0.72
18 0.74
19 0.71
20 0.65
21 0.57
22 0.52
23 0.52
24 0.46
25 0.35
26 0.25
27 0.24
28 0.21
29 0.2
30 0.26
31 0.24
32 0.25
33 0.26
34 0.27
35 0.23
36 0.24
37 0.24
38 0.19
39 0.19
40 0.17
41 0.14
42 0.14
43 0.11
44 0.1
45 0.09
46 0.07
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.05
69 0.07
70 0.08
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.06
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.05
86 0.04
87 0.05
88 0.04
89 0.04
90 0.07
91 0.09
92 0.1
93 0.09
94 0.11
95 0.12
96 0.14
97 0.14
98 0.14
99 0.17
100 0.17
101 0.17
102 0.17
103 0.16
104 0.15
105 0.15
106 0.14
107 0.1
108 0.1
109 0.11
110 0.13
111 0.14
112 0.13
113 0.13
114 0.12
115 0.11
116 0.1
117 0.08
118 0.05
119 0.04