Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G5R8

Protein Details
Accession L8G5R8    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-32DDEKSTNKHTKRVEKRRNDMSEPERBasic
NLS Segment(s)
PositionSequence
18-19KR
22-22K
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MAGKRKADDEKSTNKHTKRVEKRRNDMSEPERKIDNAKRADTAATAYAVKKLRGTQQFKDLNPTEQEERVKAKRDEVRIKRVRDGIHASIVEQNLGIGEGGGAYALWDDGNMAWETEEEVDEVTQEAMWREDEKANGYRKVDLENAQLKVEGQADATTKKFEGLGFSIWRRKWRAAYKSTLRLMKKVNTDPDFISNLPPAIDTETG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.69
4 0.73
5 0.73
6 0.78
7 0.79
8 0.81
9 0.87
10 0.9
11 0.88
12 0.83
13 0.81
14 0.78
15 0.78
16 0.71
17 0.65
18 0.56
19 0.49
20 0.52
21 0.5
22 0.5
23 0.46
24 0.44
25 0.43
26 0.42
27 0.42
28 0.35
29 0.29
30 0.22
31 0.17
32 0.16
33 0.14
34 0.19
35 0.2
36 0.2
37 0.2
38 0.21
39 0.28
40 0.37
41 0.43
42 0.4
43 0.48
44 0.54
45 0.53
46 0.58
47 0.51
48 0.45
49 0.41
50 0.42
51 0.34
52 0.32
53 0.33
54 0.27
55 0.32
56 0.31
57 0.36
58 0.33
59 0.38
60 0.39
61 0.47
62 0.54
63 0.55
64 0.63
65 0.63
66 0.65
67 0.63
68 0.61
69 0.54
70 0.48
71 0.47
72 0.38
73 0.35
74 0.32
75 0.27
76 0.26
77 0.25
78 0.2
79 0.13
80 0.11
81 0.07
82 0.07
83 0.06
84 0.03
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.06
116 0.07
117 0.09
118 0.11
119 0.12
120 0.15
121 0.21
122 0.25
123 0.28
124 0.28
125 0.28
126 0.28
127 0.3
128 0.29
129 0.26
130 0.28
131 0.3
132 0.31
133 0.28
134 0.27
135 0.24
136 0.23
137 0.21
138 0.14
139 0.1
140 0.1
141 0.11
142 0.14
143 0.14
144 0.14
145 0.13
146 0.13
147 0.14
148 0.12
149 0.14
150 0.15
151 0.18
152 0.22
153 0.26
154 0.33
155 0.35
156 0.41
157 0.42
158 0.44
159 0.49
160 0.55
161 0.59
162 0.59
163 0.67
164 0.7
165 0.74
166 0.76
167 0.75
168 0.67
169 0.63
170 0.63
171 0.59
172 0.59
173 0.57
174 0.6
175 0.56
176 0.56
177 0.53
178 0.52
179 0.49
180 0.41
181 0.36
182 0.29
183 0.26
184 0.23
185 0.21
186 0.17