Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8GA93

Protein Details
Accession L8GA93    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
253-278SEHLKRPLHSLCRKVKQRCETSRGAIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11.333, cyto 8.5, mito_nucl 8.333, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
Amino Acid Sequences MELNISTSKESIWNLTGRCLGKFQSKLQFSGSAGREISTLSRHFLFQYHESEKSIRETLVESGRKFCFSLIGTQHRQYRGRAFQMKKKKPVEIFINSRIMIDAASFQEINPNYTRPSIFKGSDSIDLWLIVDPASSNQIDESAMKSSMDLDALTDEDFLICSPTVLGFSLNDKLWLEFAVADISEISWNESLFNQVAIPSRSKKLIEALTTFQSGGKAKYTFDDFVEGKGRGLIMLLYGPPGVGKTMTAEGLSEHLKRPLHSLCRKVKQRCETSRGAIVWDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.34
4 0.31
5 0.32
6 0.31
7 0.3
8 0.34
9 0.38
10 0.41
11 0.44
12 0.45
13 0.46
14 0.47
15 0.47
16 0.39
17 0.44
18 0.39
19 0.33
20 0.3
21 0.29
22 0.25
23 0.22
24 0.23
25 0.19
26 0.18
27 0.17
28 0.18
29 0.19
30 0.19
31 0.21
32 0.24
33 0.24
34 0.3
35 0.31
36 0.32
37 0.34
38 0.34
39 0.34
40 0.33
41 0.3
42 0.23
43 0.19
44 0.19
45 0.21
46 0.29
47 0.32
48 0.28
49 0.32
50 0.33
51 0.33
52 0.31
53 0.27
54 0.23
55 0.19
56 0.25
57 0.27
58 0.34
59 0.37
60 0.42
61 0.47
62 0.48
63 0.49
64 0.45
65 0.47
66 0.45
67 0.5
68 0.55
69 0.55
70 0.59
71 0.68
72 0.73
73 0.74
74 0.72
75 0.7
76 0.64
77 0.66
78 0.65
79 0.62
80 0.6
81 0.55
82 0.55
83 0.48
84 0.45
85 0.37
86 0.29
87 0.21
88 0.14
89 0.11
90 0.07
91 0.08
92 0.08
93 0.07
94 0.13
95 0.13
96 0.15
97 0.15
98 0.15
99 0.15
100 0.17
101 0.18
102 0.14
103 0.19
104 0.21
105 0.21
106 0.21
107 0.22
108 0.23
109 0.25
110 0.24
111 0.2
112 0.15
113 0.14
114 0.14
115 0.11
116 0.09
117 0.06
118 0.05
119 0.04
120 0.04
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.07
128 0.08
129 0.07
130 0.08
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.06
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.06
154 0.05
155 0.07
156 0.1
157 0.1
158 0.11
159 0.11
160 0.1
161 0.1
162 0.1
163 0.09
164 0.06
165 0.07
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.07
174 0.07
175 0.07
176 0.08
177 0.08
178 0.09
179 0.09
180 0.09
181 0.08
182 0.09
183 0.12
184 0.13
185 0.17
186 0.18
187 0.2
188 0.23
189 0.23
190 0.23
191 0.26
192 0.29
193 0.29
194 0.29
195 0.31
196 0.3
197 0.3
198 0.29
199 0.24
200 0.22
201 0.19
202 0.17
203 0.18
204 0.17
205 0.16
206 0.19
207 0.23
208 0.21
209 0.21
210 0.26
211 0.21
212 0.24
213 0.28
214 0.26
215 0.21
216 0.21
217 0.2
218 0.14
219 0.14
220 0.1
221 0.06
222 0.07
223 0.07
224 0.07
225 0.07
226 0.07
227 0.07
228 0.07
229 0.07
230 0.06
231 0.07
232 0.09
233 0.11
234 0.12
235 0.12
236 0.11
237 0.11
238 0.14
239 0.17
240 0.16
241 0.16
242 0.21
243 0.23
244 0.23
245 0.29
246 0.34
247 0.42
248 0.48
249 0.56
250 0.61
251 0.7
252 0.79
253 0.83
254 0.84
255 0.84
256 0.87
257 0.87
258 0.84
259 0.8
260 0.76
261 0.75
262 0.65