Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8GDC3

Protein Details
Accession L8GDC3    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-68DWKPHRPARPTDKKRIPFRLEBasic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 10.5, cyto 9.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006935  Helicase/UvrB_N  
IPR014001  Helicase_ATP-bd  
IPR027417  P-loop_NTPase  
IPR004807  UvrB  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0009380  C:excinuclease repair complex  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003677  F:DNA binding  
GO:0004386  F:helicase activity  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF04851  ResIII  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
Amino Acid Sequences MARSPSKSTPQGTPKPVHAPGLQEAQAPFVQDGPTGRMPMTAPGAPVDWKPHRPARPTDKKRIPFRLETKYTPAGDQPAAIAELVETAKAGERDQVLLGVTGSGKTFTMAKVIEQTQRPALILAHNKTLAAQLYSEFKSFFPDNAVEYFVSYYDYYQPEAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.6
4 0.55
5 0.47
6 0.43
7 0.4
8 0.42
9 0.37
10 0.31
11 0.29
12 0.27
13 0.26
14 0.23
15 0.19
16 0.14
17 0.14
18 0.12
19 0.14
20 0.16
21 0.17
22 0.17
23 0.16
24 0.16
25 0.16
26 0.18
27 0.21
28 0.16
29 0.14
30 0.14
31 0.15
32 0.15
33 0.16
34 0.2
35 0.21
36 0.23
37 0.29
38 0.36
39 0.4
40 0.44
41 0.52
42 0.56
43 0.63
44 0.68
45 0.73
46 0.75
47 0.78
48 0.81
49 0.82
50 0.76
51 0.73
52 0.72
53 0.71
54 0.66
55 0.6
56 0.57
57 0.52
58 0.48
59 0.4
60 0.34
61 0.26
62 0.22
63 0.19
64 0.13
65 0.09
66 0.08
67 0.08
68 0.06
69 0.04
70 0.05
71 0.04
72 0.04
73 0.04
74 0.03
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.09
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.09
96 0.09
97 0.09
98 0.13
99 0.16
100 0.21
101 0.22
102 0.25
103 0.24
104 0.24
105 0.24
106 0.2
107 0.18
108 0.2
109 0.25
110 0.25
111 0.27
112 0.26
113 0.26
114 0.25
115 0.27
116 0.22
117 0.15
118 0.13
119 0.11
120 0.16
121 0.18
122 0.18
123 0.17
124 0.15
125 0.21
126 0.21
127 0.2
128 0.2
129 0.19
130 0.21
131 0.21
132 0.24
133 0.18
134 0.18
135 0.18
136 0.13
137 0.15
138 0.13
139 0.13
140 0.17
141 0.18