Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8G7M4

Protein Details
Accession L8G7M4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-81VPNCHRHYPKLPHPHRNPATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 6
Family & Domain DBs
Amino Acid Sequences MATLAGMLTKLPANSNISDLLLAIETPPPKHEHDTPPGAATPRIFKVGHEWLPAITLYCRTVPNCHRHYPKLPHPHRNPATSSTIERSSSTLLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.19
4 0.17
5 0.17
6 0.15
7 0.13
8 0.09
9 0.08
10 0.07
11 0.09
12 0.1
13 0.1
14 0.12
15 0.14
16 0.17
17 0.21
18 0.26
19 0.3
20 0.35
21 0.4
22 0.39
23 0.37
24 0.36
25 0.33
26 0.28
27 0.22
28 0.19
29 0.15
30 0.18
31 0.16
32 0.15
33 0.19
34 0.24
35 0.25
36 0.23
37 0.22
38 0.18
39 0.19
40 0.19
41 0.14
42 0.09
43 0.08
44 0.09
45 0.1
46 0.12
47 0.12
48 0.19
49 0.25
50 0.34
51 0.38
52 0.45
53 0.49
54 0.54
55 0.62
56 0.64
57 0.68
58 0.7
59 0.73
60 0.76
61 0.76
62 0.82
63 0.78
64 0.74
65 0.68
66 0.62
67 0.59
68 0.52
69 0.49
70 0.43
71 0.41
72 0.38
73 0.35
74 0.32
75 0.3