Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G3J6

Protein Details
Accession L8G3J6   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-67SDISRRKKLLEKQKKGRKKLGGEBasic
NLS Segment(s)
PositionSequence
49-64RRKKLLEKQKKGRKKL
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, mito 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006297  EF-4  
IPR038363  LepA_C_sf  
IPR013842  LepA_CTD  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF06421  LepA_C  
Amino Acid Sequences MKKFKELVDRQMYEVIIQAMAGRRIVARETIKPFRTDVLAKLHASDISRRKKLLEKQKKGRKKLGGEYHDSAGGFPEVLGQVVFVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.25
3 0.14
4 0.12
5 0.12
6 0.11
7 0.11
8 0.11
9 0.1
10 0.09
11 0.1
12 0.11
13 0.15
14 0.16
15 0.21
16 0.28
17 0.35
18 0.36
19 0.36
20 0.36
21 0.32
22 0.32
23 0.27
24 0.23
25 0.23
26 0.25
27 0.23
28 0.23
29 0.23
30 0.21
31 0.2
32 0.23
33 0.25
34 0.29
35 0.32
36 0.31
37 0.33
38 0.4
39 0.47
40 0.53
41 0.56
42 0.59
43 0.68
44 0.78
45 0.85
46 0.85
47 0.86
48 0.83
49 0.8
50 0.79
51 0.79
52 0.74
53 0.72
54 0.68
55 0.6
56 0.53
57 0.45
58 0.35
59 0.27
60 0.21
61 0.13
62 0.1
63 0.11
64 0.09
65 0.09
66 0.09