Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FW49

Protein Details
Accession L8FW49    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-79DAVRKHPPPPPRRHARKVSTBasic
NLS Segment(s)
PositionSequence
64-75KHPPPPPRRHAR
Subcellular Location(s) mito 15, nucl 11, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MSPPNMSTSSSSQSSTTAVGTPRAYHRSSPSLTPELAYKVAAWLETQPPVSTYRPMASIDAVRKHPPPPPRRHARKVSTGYPTSLTTRKSLVVAAAATGRVRNPPRPSLACGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.18
4 0.16
5 0.15
6 0.18
7 0.18
8 0.2
9 0.24
10 0.28
11 0.28
12 0.28
13 0.32
14 0.35
15 0.36
16 0.36
17 0.37
18 0.35
19 0.34
20 0.31
21 0.28
22 0.24
23 0.22
24 0.19
25 0.13
26 0.11
27 0.11
28 0.11
29 0.09
30 0.09
31 0.1
32 0.11
33 0.11
34 0.1
35 0.11
36 0.14
37 0.15
38 0.14
39 0.14
40 0.13
41 0.14
42 0.15
43 0.14
44 0.12
45 0.15
46 0.17
47 0.19
48 0.2
49 0.21
50 0.22
51 0.23
52 0.27
53 0.33
54 0.39
55 0.45
56 0.53
57 0.61
58 0.69
59 0.76
60 0.81
61 0.78
62 0.79
63 0.76
64 0.73
65 0.69
66 0.61
67 0.54
68 0.47
69 0.43
70 0.37
71 0.34
72 0.3
73 0.24
74 0.24
75 0.23
76 0.22
77 0.2
78 0.17
79 0.16
80 0.14
81 0.13
82 0.13
83 0.12
84 0.12
85 0.12
86 0.12
87 0.18
88 0.22
89 0.29
90 0.35
91 0.4
92 0.48
93 0.52