Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PIW5

Protein Details
Accession L0PIW5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
154-181SSTYRDFLNHKKKHQLKKIKENIRFSEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045149  OS-9-like  
Gene Ontology GO:0005788  C:endoplasmic reticulum lumen  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0030246  F:carbohydrate binding  
GO:0030968  P:endoplasmic reticulum unfolded protein response  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
Amino Acid Sequences MCEPDAYDKIVFVTEISACSYKIVVHTSRLCKEPFFNQLTSKNAHVINCERILDDDEYVKWMNVMFPKTTNSQHLGFLHPGSHNHIFVQKSSLKKINGKGLHGRNNRKDERVTRSLKEGSQEYLVLLNHPEETEKPNNGENNAGTIFVTTIYDSSTYRDFLNHKKKHQLKKIKENIRFSEQMEKDENKEQKTRDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.14
5 0.13
6 0.14
7 0.14
8 0.13
9 0.15
10 0.19
11 0.17
12 0.23
13 0.31
14 0.37
15 0.41
16 0.44
17 0.42
18 0.39
19 0.41
20 0.39
21 0.4
22 0.38
23 0.37
24 0.38
25 0.42
26 0.43
27 0.42
28 0.38
29 0.34
30 0.32
31 0.3
32 0.29
33 0.28
34 0.3
35 0.29
36 0.28
37 0.24
38 0.23
39 0.26
40 0.22
41 0.19
42 0.15
43 0.13
44 0.15
45 0.15
46 0.14
47 0.11
48 0.1
49 0.12
50 0.14
51 0.16
52 0.14
53 0.15
54 0.18
55 0.21
56 0.23
57 0.24
58 0.23
59 0.23
60 0.25
61 0.25
62 0.25
63 0.23
64 0.22
65 0.2
66 0.18
67 0.17
68 0.19
69 0.2
70 0.17
71 0.17
72 0.2
73 0.19
74 0.18
75 0.22
76 0.2
77 0.2
78 0.24
79 0.28
80 0.27
81 0.31
82 0.34
83 0.38
84 0.37
85 0.38
86 0.42
87 0.43
88 0.5
89 0.53
90 0.58
91 0.56
92 0.63
93 0.62
94 0.57
95 0.56
96 0.52
97 0.52
98 0.53
99 0.5
100 0.43
101 0.46
102 0.45
103 0.41
104 0.38
105 0.32
106 0.25
107 0.22
108 0.2
109 0.15
110 0.15
111 0.14
112 0.12
113 0.11
114 0.1
115 0.09
116 0.09
117 0.09
118 0.08
119 0.14
120 0.18
121 0.19
122 0.21
123 0.25
124 0.27
125 0.26
126 0.28
127 0.22
128 0.21
129 0.2
130 0.18
131 0.14
132 0.12
133 0.11
134 0.09
135 0.09
136 0.06
137 0.06
138 0.06
139 0.07
140 0.08
141 0.1
142 0.12
143 0.12
144 0.12
145 0.16
146 0.2
147 0.29
148 0.4
149 0.45
150 0.49
151 0.59
152 0.68
153 0.75
154 0.82
155 0.82
156 0.82
157 0.86
158 0.91
159 0.9
160 0.89
161 0.88
162 0.83
163 0.8
164 0.72
165 0.63
166 0.63
167 0.54
168 0.51
169 0.48
170 0.44
171 0.41
172 0.47
173 0.5
174 0.45
175 0.5