Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L0PFX8

Protein Details
Accession L0PFX8    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
153-181APKTPDKYRDDYKKKEKRIKRAIEKGYANBasic
191-216ALEIRRNRQLKEKRRLKNARPPKKKHBasic
NLS Segment(s)
PositionSequence
154-180PKTPDKYRDDYKKKEKRIKRAIEKGYA
185-216KSELKSALEIRRNRQLKEKRRLKNARPPKKKH
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012541  DBP10_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0003723  F:RNA binding  
GO:0003724  F:RNA helicase activity  
Pfam View protein in Pfam  
PF08147  DBP10CT  
Amino Acid Sequences MINKKNYKDEENYMSHYTSISSMREHAYDINKSDYSFEKEANNAVFDIMGDDKNPTQTGTRANGVRWSFKKRKLVSRMDDHDGSKKELKMIKGESGVKIPATYKTGRYAIWKNSKKVTQQKVGEIENCKSYAIPKNSHTNISGRRYKHNKLQAPKTPDKYRDDYKKKEKRIKRAIEKGYANINVKSELKSALEIRRNRQLKEKRRLKNARPPKKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.35
4 0.28
5 0.23
6 0.21
7 0.17
8 0.16
9 0.17
10 0.19
11 0.2
12 0.2
13 0.22
14 0.25
15 0.28
16 0.29
17 0.32
18 0.3
19 0.3
20 0.31
21 0.3
22 0.31
23 0.29
24 0.28
25 0.25
26 0.26
27 0.29
28 0.28
29 0.25
30 0.18
31 0.16
32 0.14
33 0.11
34 0.12
35 0.1
36 0.09
37 0.08
38 0.1
39 0.1
40 0.12
41 0.13
42 0.12
43 0.12
44 0.14
45 0.19
46 0.21
47 0.26
48 0.25
49 0.26
50 0.31
51 0.32
52 0.37
53 0.36
54 0.42
55 0.44
56 0.5
57 0.59
58 0.58
59 0.66
60 0.67
61 0.73
62 0.7
63 0.72
64 0.7
65 0.66
66 0.63
67 0.54
68 0.51
69 0.44
70 0.41
71 0.35
72 0.3
73 0.3
74 0.31
75 0.3
76 0.29
77 0.3
78 0.28
79 0.29
80 0.3
81 0.26
82 0.24
83 0.23
84 0.18
85 0.16
86 0.14
87 0.12
88 0.13
89 0.13
90 0.13
91 0.16
92 0.17
93 0.18
94 0.22
95 0.25
96 0.3
97 0.39
98 0.43
99 0.42
100 0.46
101 0.49
102 0.52
103 0.56
104 0.55
105 0.53
106 0.51
107 0.53
108 0.52
109 0.5
110 0.47
111 0.41
112 0.35
113 0.28
114 0.26
115 0.21
116 0.17
117 0.19
118 0.23
119 0.25
120 0.27
121 0.28
122 0.37
123 0.38
124 0.41
125 0.38
126 0.36
127 0.39
128 0.43
129 0.46
130 0.4
131 0.48
132 0.53
133 0.56
134 0.59
135 0.62
136 0.62
137 0.64
138 0.72
139 0.71
140 0.73
141 0.76
142 0.76
143 0.73
144 0.71
145 0.69
146 0.66
147 0.66
148 0.68
149 0.69
150 0.71
151 0.74
152 0.78
153 0.82
154 0.86
155 0.86
156 0.86
157 0.88
158 0.89
159 0.88
160 0.89
161 0.86
162 0.84
163 0.78
164 0.71
165 0.67
166 0.62
167 0.54
168 0.45
169 0.39
170 0.34
171 0.32
172 0.31
173 0.25
174 0.21
175 0.2
176 0.22
177 0.25
178 0.3
179 0.37
180 0.41
181 0.45
182 0.53
183 0.56
184 0.55
185 0.61
186 0.63
187 0.66
188 0.71
189 0.76
190 0.75
191 0.82
192 0.9
193 0.89
194 0.9
195 0.9
196 0.91