Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L0PCV3

Protein Details
Accession L0PCV3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
108-133SLKNAKLSPIKKQKKRDGSEHFYKYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, mito 3, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008936  Rho_GTPase_activation_prot  
IPR000198  RhoGAP_dom  
Gene Ontology GO:0005938  C:cell cortex  
GO:0032153  C:cell division site  
GO:0005096  F:GTPase activator activity  
GO:0007165  P:signal transduction  
PROSITE View protein in PROSITE  
PS50238  RHOGAP  
Amino Acid Sequences MEAIFLFLNWVASFANINKESGNKMDIYNLATVITPDILYSKNRKTRVDEAILAIKVVYTLIEFIDKFSLVPTDLLSTLHDLCMLIKNPDLNIKDMLKEYEKILEINSLKNAKLSPIKKQKKRDGSEHFYKYQQLFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.19
3 0.18
4 0.19
5 0.19
6 0.21
7 0.23
8 0.23
9 0.23
10 0.16
11 0.16
12 0.18
13 0.19
14 0.19
15 0.17
16 0.15
17 0.14
18 0.12
19 0.12
20 0.1
21 0.09
22 0.06
23 0.06
24 0.07
25 0.08
26 0.11
27 0.16
28 0.24
29 0.31
30 0.35
31 0.38
32 0.44
33 0.49
34 0.53
35 0.52
36 0.46
37 0.41
38 0.42
39 0.39
40 0.32
41 0.24
42 0.17
43 0.12
44 0.1
45 0.08
46 0.03
47 0.03
48 0.03
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.09
65 0.09
66 0.08
67 0.08
68 0.07
69 0.07
70 0.11
71 0.11
72 0.1
73 0.11
74 0.12
75 0.12
76 0.19
77 0.19
78 0.17
79 0.2
80 0.2
81 0.21
82 0.21
83 0.24
84 0.2
85 0.2
86 0.19
87 0.19
88 0.19
89 0.18
90 0.17
91 0.21
92 0.2
93 0.21
94 0.26
95 0.24
96 0.23
97 0.24
98 0.24
99 0.23
100 0.31
101 0.31
102 0.36
103 0.46
104 0.56
105 0.64
106 0.74
107 0.8
108 0.81
109 0.86
110 0.86
111 0.85
112 0.83
113 0.85
114 0.81
115 0.74
116 0.66
117 0.66